Clone LP07806 Report

Search the DGRC for LP07806

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:78
Well:6
Vector:pOT2
Associated Gene/TranscriptFbp2-RA
Protein status:LP07806.pep: gold
Preliminary Size:1031
Sequenced Size:922

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3763 2001-01-01 Release 2 assignment
CG3763 2003-01-01 Sim4 clustering to Release 3
CG3763 2003-01-13 Blastp of sequenced clone
Fbp2 2008-04-29 Release 5.5 accounting
Fbp2 2008-08-15 Release 5.9 accounting
Fbp2 2008-12-18 5.12 accounting

Clone Sequence Records

LP07806.complete Sequence

922 bp (922 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061549

> LP07806.complete
TTAGTCACTCATCACATCACAATCCAAGCCACGTCAACCCCAAATAATTA
ACCCCAAGCAAAAATGTTTGACTGGACCGGTAAGAATGTTGTCTATGTGG
GCAGCTTCAGCGGCATTGGATGGCAGATGATGATGCAGCTGATGCAGAAG
GACATCAAGATGATGGGCATTATGCATCGCATGGAGAACGTTAAGATGAT
GAAGAAGCTGCAGGCCATTAATCCATCCGTGAAAGTGGTCTTCATGCAAA
TGAACCTCATGGAAAAGATGTCGATCGAACAGGCGATGAAGAAAATGGGT
CAAATGATGGGACACATTGATGTGATGATCAATGGCGAGGGTGTCCTGCT
CGACAAGGATGTGGAGACTACGATGGGCATGAATCTGACTGGCATGATCC
AGTCGACGATGATGGCCATGCCCTACATGGACAAGACACAGATGGGCATG
GGTGGCATGGTGGTTAACATGTCCTCTGTCTATGGCCTGGAACCCGCGCC
CGCCTTTTCTGTCTACGCCGCTGCCATGCACGGCATCCTCGGATTCACCC
GCTCCATGGGCGACAAGATGATCTACCAAAAGACCGGCGTCATGTTCATG
GCCATGTGCCCGGGACTCACCAACAGCGAGATGATTATGAACCTGCGCGA
CAACGTTACCTGGCACCACTCCGAATCCATGGTGGAGGCCATCGAGAGCG
CCAAGCGCCAAATGCCCGAGGAGGCAGCCATGCAAATGATCCACGCGATG
GAGATGATGAAGAACGGCAGCATGTGGATTGTGAGCATGGGCCAGCTGAA
GGAGGTTACGCCCACGATGCACTGGCAGATGTAAATGGCTTAGTTGAGCG
ATTATTTGTTAAATCATTTCAAAAAAAAAATATATAAAAATATTAGGCCT
CCCAAAAAAAAAAAAAAAAAAA

LP07806.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp2.b 1256 Fbp2.b 352..1256 1..904 4485 99.8 Plus
Fbp2-RA 1049 Fbp2-RA 82..986 1..904 4485 99.8 Plus
Fbp2.a 849 Fbp2.a 91..849 147..904 3755 99.8 Plus
Fbp2.a 849 Fbp2.a 13..91 1..79 395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9426255..9426771 387..903 2555 99.6 Plus
chr2L 23010047 chr2L 9425809..9426195 1..387 1890 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9427318..9427836 387..904 2545 99.8 Plus
2L 23513712 2L 9426872..9427258 1..387 1935 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9427318..9427836 387..904 2555 99.8 Plus
2L 23513712 2L 9426872..9427258 1..387 1935 100 Plus
Blast to na_te.dros performed 2019-03-16 12:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1326..1388 833..892 119 68.3 Plus

LP07806.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:20:37 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9425809..9426195 1..387 99 -> Plus
chr2L 9426256..9426737 388..869 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:41 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 1..771 64..834 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:10 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 1..771 64..834 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:13:32 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 1..771 64..834 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:00 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 1..771 64..834 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:03 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 1..771 64..834 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:38 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 13..916 1..903 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:10 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 13..916 1..903 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:13:32 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 13..916 1..903 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:00 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 13..916 1..903 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:03 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp2-RA 13..916 1..903 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:37 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9426872..9427258 1..387 100 -> Plus
2L 9427319..9427835 388..903 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:37 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9426872..9427258 1..387 100 -> Plus
2L 9427319..9427835 388..903 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:37 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9426872..9427258 1..387 100 -> Plus
2L 9427319..9427835 388..903 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:13:32 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9426872..9427258 1..387 100 -> Plus
arm_2L 9427319..9427835 388..903 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:24 Download gff for LP07806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9426872..9427258 1..387 100 -> Plus
2L 9427319..9427835 388..903 99   Plus

LP07806.pep Sequence

Translation from 63 to 833

> LP07806.pep
MFDWTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQ
AINPSVKVVFMQMNLMEKMSIEQAMKKMGQMMGHIDVMINGEGVLLDKDV
ETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVVNMSSVYGLEPAPAFSV
YAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLRDNVTW
HHSESMVEAIESAKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVTP
TMHWQM*

LP07806.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10118-PA 259 GF10118-PA 2..253 3..254 549 38.1 Plus
Dana\GF24389-PA 261 GF24389-PA 3..240 4..240 425 32.8 Plus
Dana\Adhr-PA 272 GF14889-PA 1..255 1..256 423 32.7 Plus
Dana\Adh-PA 256 GF14888-PA 6..253 5..255 343 27.7 Plus
Dana\GF12913-PA 372 GF12913-PA 123..369 6..255 325 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25347-PA 256 GG25347-PA 1..256 1..256 1211 94.9 Plus
Dere\GG16001-PA 259 GG16001-PA 2..254 3..255 508 34.4 Plus
Dere\Adhr-PA 272 GG25121-PA 1..255 1..256 434 33.1 Plus
Dere\GG13462-PA 261 GG13462-PA 3..247 4..250 427 33.1 Plus
Dere\Adh-PA 256 GG25120-PA 3..253 2..255 352 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13326-PA 257 GH13326-PA 1..257 1..256 956 74.7 Plus
Dgri\GH15889-PA 261 GH15889-PA 2..254 3..255 518 35.2 Plus
Dgri\GH13404-PA 274 GH13404-PA 1..255 1..256 479 34.6 Plus
Dgri\GH15599-PA 261 GH15599-PA 5..254 6..254 411 31.6 Plus
Dgri\Adh-PA 254 GH13025-PA 7..251 8..255 317 26.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp2-PC 256 CG3763-PC 1..256 1..256 1333 100 Plus
Fbp2-PB 256 CG3763-PB 1..256 1..256 1333 100 Plus
Fbp2-PA 256 CG3763-PA 1..256 1..256 1333 100 Plus
CG4842-PA 259 CG4842-PA 2..254 3..255 494 36 Plus
CG18814-PB 267 CG18814-PB 2..254 3..254 463 34.4 Plus
Adhr-PC 272 CG3484-PC 1..255 1..256 421 33.5 Plus
Adhr-PB 272 CG3484-PB 1..255 1..256 421 33.5 Plus
Adhr-PA 272 CG3484-PA 1..255 1..256 421 33.5 Plus
Pdh-PC 261 CG4899-PC 5..240 6..240 415 33.5 Plus
Pdh-PA 278 CG4899-PA 22..257 6..240 415 33.5 Plus
Pdh-PD 260 CG4899-PD 5..239 6..240 404 33.5 Plus
Pdh-PB 277 CG4899-PB 22..256 6..240 404 33.5 Plus
Adh-PE 256 CG3481-PE 3..252 2..254 329 29.4 Plus
Adh-PF 256 CG3481-PF 3..252 2..254 329 29.4 Plus
Adh-PH 256 CG3481-PH 3..252 2..254 329 29.4 Plus
Adh-PI 256 CG3481-PI 3..252 2..254 329 29.4 Plus
Adh-PC 256 CG3481-PC 3..252 2..254 329 29.4 Plus
CG40485-PC 247 CG40485-PC 4..204 4..191 151 24.1 Plus
CG40485-PB 247 CG40485-PB 4..204 4..191 151 24.1 Plus
rdhB-PB 248 CG7077-PB 5..202 2..191 150 22.3 Plus
rdhB-PA 248 CG7077-PA 5..202 2..191 150 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17665-PA 258 GI17665-PA 1..258 1..256 997 78.7 Plus
Dmoj\GI16540-PA 257 GI16540-PA 2..252 3..255 534 37.5 Plus
Dmoj\GI17645-PA 276 GI17645-PA 1..255 1..256 481 35.4 Plus
Dmoj\GI16877-PA 261 GI16877-PA 3..240 4..240 428 33.6 Plus
Dmoj\Adh1-PA 254 GI17644-PA 6..251 7..255 337 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26147-PA 256 GL26147-PA 1..256 1..256 1141 87.9 Plus
Dper\GL17859-PA 258 GL17859-PA 2..254 3..255 526 34.8 Plus
Dper\Adh-PA 254 GL25993-PA 4..251 5..255 362 29.6 Plus
Dper\Adhr-PA 267 GL25994-PA 1..244 1..256 357 29.6 Plus
Dper\GL26015-PA 820 GL26015-PA 570..816 5..254 344 29.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17670-PA 256 GA17670-PA 1..256 1..256 1142 88.3 Plus
Dpse\GA18471-PA 258 GA18471-PA 2..254 3..255 533 35.6 Plus
Dpse\Adhr-PA 278 GA25223-PA 1..255 1..256 426 31.9 Plus
Dpse\GA18512-PA 261 GA18512-PA 3..240 4..240 418 32.8 Plus
Dpse\Adh-PA 254 GA17214-PA 4..251 5..255 362 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17449-PA 256 GM17449-PA 1..256 1..256 1286 96.5 Plus
Dsec\GM25632-PA 259 GM25632-PA 2..254 3..255 494 34 Plus
Dsec\GM25633-PA 267 GM25633-PA 2..248 3..248 483 34.8 Plus
Dsec\Adhr-PA 272 GM15667-PA 1..255 1..256 441 33.1 Plus
Dsec\GM24411-PA 261 GM24411-PA 3..247 4..250 426 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Fbp2-PA 256 GD23602-PA 1..256 1..256 1285 96.1 Plus
Dsim\GD14635-PA 259 GD14635-PA 2..254 3..255 497 34.8 Plus
Dsim\Adhr-PA 272 GD23969-PA 1..255 1..256 441 33.1 Plus
Dsim\GD12481-PA 261 GD12481-PA 3..247 4..250 427 33.1 Plus
Dsim\Adh-PA 256 GD23968-PA 3..253 2..255 355 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17861-PA 257 GJ17861-PA 1..257 1..256 1014 78.6 Plus
Dvir\GJ12792-PA 259 GJ12792-PA 2..254 3..255 507 36 Plus
Dvir\Adhr-PA 275 GJ18210-PA 1..255 1..256 476 36.2 Plus
Dvir\GJ12626-PA 261 GJ12626-PA 3..254 4..254 421 32.1 Plus
Dvir\Adh1-PA 254 GJ18208-PA 6..251 7..255 334 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24204-PA 256 GK24204-PA 1..256 1..256 1162 88.7 Plus
Dwil\GK14485-PA 260 GK14485-PA 2..255 3..255 483 35 Plus
Dwil\GK17292-PA 259 GK17292-PA 6..253 7..254 468 36.3 Plus
Dwil\GK18292-PA 273 GK18292-PA 1..255 1..256 448 33.1 Plus
Dwil\GK17293-PA 259 GK17293-PA 4..253 5..254 421 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18839-PA 256 GE18839-PA 1..256 1..256 1204 94.5 Plus
Dyak\GE23094-PA 259 GE23094-PA 2..254 3..255 515 35.6 Plus
Dyak\GE23092-PA 259 GE23092-PA 2..254 3..255 504 35.2 Plus
Dyak\GE23095-PA 260 GE23095-PA 2..255 3..255 476 33.5 Plus
Dyak\GE23093-PA 260 GE23093-PA 2..255 3..255 473 33.5 Plus

LP07806.hyp Sequence

Translation from 63 to 833

> LP07806.hyp
MFDWTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQ
AINPSVKVVFMQMNLMEKMSIEQAMKKMGQMMGHIDVMINGEGVLLDKDV
ETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVVNMSSVYGLEPAPAFSV
YAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLRDNVTW
HHSESMVEAIESAKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVTP
TMHWQM*

LP07806.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp2-PC 256 CG3763-PC 1..256 1..256 1333 100 Plus
Fbp2-PB 256 CG3763-PB 1..256 1..256 1333 100 Plus
Fbp2-PA 256 CG3763-PA 1..256 1..256 1333 100 Plus
CG4842-PA 259 CG4842-PA 2..254 3..255 494 36 Plus
CG18814-PB 267 CG18814-PB 2..254 3..254 463 34.4 Plus