Clone LP07813 Report

Search the DGRC for LP07813

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:78
Well:13
Vector:pOT2
Associated Gene/TranscriptCpr49Ac-RA
Protein status:LP07813.pep: gold
Preliminary Size:1571
Sequenced Size:1343

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8502 2001-07-04 Blastp of sequenced clone
Cpr49Ac 2008-04-29 Release 5.5 accounting
Cpr49Ac 2008-08-15 Release 5.9 accounting
Cpr49Ac 2008-12-18 5.12 accounting

Clone Sequence Records

LP07813.complete Sequence

1343 bp (1343 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052054

> LP07813.complete
CGCCTTTCGAGCAGGATTACCATCTCAGTTATCTTAACGAAAAAGGATAC
TTTCCCCTAAAGGATACTCAAAGCCAACATGTTCACCAAGTCAATGCTGA
GCTTCTCCCTGGTCGTGGCCCTCTTCGTTGTCTGCCACGCCAGTCCCGTT
CCGGATAATAATGGCCGGAGTGGTTCGCAAGAAAGTATAGGTCGCTATCA
TCACATGCCGATTCCCTACAGACATGTGAGCGATCAGCGTGAGCTTGGAA
AATACCATCACATTCCCTATCCCTATGACGGAGGCTATGGACCCTACGCT
GGTTCGAATATTCCCTATGTCCATGACGACAGGCCTTACAACCACGACCT
GTACACAAGCACGACCACCAAGAAACCAACCACGACCACCAAAAGGACGA
CAACCTCGACCACCACCACCACCACCACGCCCCGCAATATTCTGTTCAAC
TACGATGATGAGGGTCGCCACAAGATCCTGCACAAGGAAGAGGTCCGCAA
ACAGGACAAATACGATCACTCTTACCTGACTGAGAATGGAATCTATGGCG
AGGAGCAGGCCAAGCTTCACCACACCGGAGGCACACATGCCAAGGGATTC
TATGAGTACACCGGTGACGATGGCAAGCTTTATCGCGTAAACTACGCCTC
CAACGATGGCGGCTTCATGCCCCAGGGAGACCACATTCACCCGATCCCCG
ATGCCATTGTCCGTGCCCTCAAGTACGTGGAGGAGCAGCACAAGATCAAC
GGTGGGGCTCAGTTCGACCATCGCGGCTTCCGCATCAATCACATGACCAA
GGACCTTAAGGCGCAGATCAAGGCGATCCATCTGGAGGAGATGCCCAAGG
AGCTGACCGAGCAGATCCATATGCTGGAGCACGAGGTGGAGCTCGCCGAG
GAGGAGGAGCGCGAGGAGCAGGCCGCATTGGAGCGACTCCGCCAGGCAGC
AAAGTCCCACTAAGTGTCGAGCCTGAGCTGCCCTCATTCACAGCCATATG
TTCCCGCTACCCAAGCCCCCAAAAACAGTCCTAGTCCCAACTCCAACATC
CAACTCCATTCCCCATGCATTTGCCGAGTGATCAACGGGCAAAACCTATA
ACAAGCCATCGCAATACCGAAAAAAATCCACAAAAAAAGCAAAAGGAAGG
TGAAGATGTCAACATATCGAGTGGCAACCGGAGAATATTCGCACATAAGT
CCGATCCCATGTTATTTCGTATTTATTTATCTGTCGAACTGTCGAATTTG
ACGATGTTGCTATGCATAAGATAATTAATTTGTTATTATCGTATATCGAA
ATAAAACCTACTAAATATTTGTTATAAAAAAAAAAAAAAAAAA

LP07813.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ac.h 2153 Cpr49Ac.h 916..2081 163..1328 5830 100 Plus
Cpr49Ac-RC 1770 Cpr49Ac-RC 429..1594 163..1328 5830 100 Plus
Cpr49Ac.d 1990 Cpr49Ac.d 824..1989 163..1328 5830 100 Plus
Cpr49Ac.h 2153 Cpr49Ac.h 664..828 1..165 825 100 Plus
Cpr49Ac-RC 1770 Cpr49Ac-RC 177..341 1..165 825 100 Plus
Cpr49Ac.d 1990 Cpr49Ac.d 177..341 1..165 825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8276480..8277283 522..1325 4005 99.9 Plus
chr2R 21145070 chr2R 8276149..8276312 358..521 820 100 Plus
chr2R 21145070 chr2R 8275533..8275685 189..341 765 100 Plus
chr2R 21145070 chr2R 8274214..8274331 1..118 590 100 Plus
chr2R 21145070 chr2R 8274616..8274664 117..165 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12389254..12390060 522..1328 4035 100 Plus
2R 25286936 2R 12388923..12389086 358..521 820 100 Plus
2R 25286936 2R 12388298..12388450 189..341 765 100 Plus
2R 25286936 2R 12386979..12387096 1..118 590 100 Plus
2R 25286936 2R 12387381..12387429 117..165 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12390453..12391259 522..1328 4035 100 Plus
2R 25260384 2R 12390122..12390285 358..521 820 100 Plus
2R 25260384 2R 12389497..12389649 189..341 765 100 Plus
2R 25260384 2R 12388178..12388295 1..118 590 100 Plus
2R 25260384 2R 12388580..12388628 117..165 245 100 Plus
2R 25260384 2R 12389111..12389140 163..192 150 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:34:26 has no hits.

LP07813.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:35:35 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8274214..8274330 1..117 100 -> Plus
chr2R 8274617..8274662 118..163 100 -> Plus
chr2R 8275148..8275174 164..190 100 -> Plus
chr2R 8275535..8275685 191..341 100 -> Plus
chr2R 8275744..8275759 342..357 100 -> Plus
chr2R 8276149..8276312 358..521 87 -> Plus
chr2R 8276480..8277283 522..1325 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:42 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..885 79..963 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:13:51 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..885 79..963 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:22 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..885 79..963 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:45:08 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..885 79..963 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:23 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..885 79..963 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:06:42 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..1325 1..1325 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:13:51 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 13..1337 1..1325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:22 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 20..1344 1..1325 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:45:08 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 1..1325 1..1325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:23 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ac-RA 20..1344 1..1325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:35 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12388300..12388450 191..341 100 -> Plus
2R 12388518..12388533 342..357 100 -> Plus
2R 12388923..12389086 358..521 100 -> Plus
2R 12386979..12387095 1..117 100 -> Plus
2R 12387382..12387427 118..163 100 -> Plus
2R 12387913..12387939 164..190 100 -> Plus
2R 12389254..12390057 522..1325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:35 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12388300..12388450 191..341 100 -> Plus
2R 12388518..12388533 342..357 100 -> Plus
2R 12388923..12389086 358..521 100 -> Plus
2R 12386979..12387095 1..117 100 -> Plus
2R 12387382..12387427 118..163 100 -> Plus
2R 12387913..12387939 164..190 100 -> Plus
2R 12389254..12390057 522..1325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:35 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12388300..12388450 191..341 100 -> Plus
2R 12388518..12388533 342..357 100 -> Plus
2R 12388923..12389086 358..521 100 -> Plus
2R 12386979..12387095 1..117 100 -> Plus
2R 12387382..12387427 118..163 100 -> Plus
2R 12387913..12387939 164..190 100 -> Plus
2R 12389254..12390057 522..1325 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:22 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8274484..8274600 1..117 100 -> Plus
arm_2R 8274887..8274932 118..163 100 -> Plus
arm_2R 8275418..8275444 164..190 100 -> Plus
arm_2R 8275805..8275955 191..341 100 -> Plus
arm_2R 8276023..8276038 342..357 100 -> Plus
arm_2R 8276428..8276591 358..521 100 -> Plus
arm_2R 8276759..8277562 522..1325 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:22:54 Download gff for LP07813.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12389717..12389732 342..357 100 -> Plus
2R 12388178..12388294 1..117 100 -> Plus
2R 12388581..12388626 118..163 100 -> Plus
2R 12389112..12389138 164..190 100 -> Plus
2R 12389499..12389649 191..341 100 -> Plus
2R 12390122..12390285 358..521 100 -> Plus
2R 12390453..12391256 522..1325 100   Plus

LP07813.pep Sequence

Translation from 78 to 962

> LP07813.pep
MFTKSMLSFSLVVALFVVCHASPVPDNNGRSGSQESIGRYHHMPIPYRHV
SDQRELGKYHHIPYPYDGGYGPYAGSNIPYVHDDRPYNHDLYTSTTTKKP
TTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILHKEEVRKQDKYDHSYL
TENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQG
DHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLKAQIKAI
HLEEMPKELTEQIHMLEHEVELAEEEEREEQAALERLRQAAKSH*

LP07813.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12855-PA 324 GF12855-PA 1..298 1..265 1050 75.8 Plus
Dana\GF12853-PA 264 GF12853-PA 165..238 133..203 175 50 Plus
Dana\GF10925-PA 107 GF10925-PA 21..105 132..210 143 32.9 Plus
Dana\GF10617-PA 121 GF10617-PA 20..111 127..218 140 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20290-PA 324 GG20290-PA 1..323 1..293 1227 87 Plus
Dere\GG20287-PA 260 GG20287-PA 162..235 133..203 167 47.3 Plus
Dere\GG14999-PA 178 GG14999-PA 38..116 138..216 151 37.3 Plus
Dere\GG14082-PA 107 GG14082-PA 37..107 143..209 145 40.8 Plus
Dere\GG15459-PA 122 GG15459-PA 20..111 126..218 141 32.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20695-PA 325 GH20695-PA 1..298 1..265 843 65.8 Plus
Dgri\GH20693-PA 255 GH20693-PA 49..255 24..223 176 28.1 Plus
Dgri\GH20692-PA 142 GH20692-PA 29..105 132..203 152 44.2 Plus
Dgri\GH15846-PA 106 GH15846-PA 21..100 128..203 150 37.5 Plus
Dgri\GH15845-PA 106 GH15845-PA 21..100 128..203 150 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ac-PA 294 CG8502-PA 1..294 1..294 1594 100 Plus
Cpr49Ac-PC 324 CG8502-PC 1..324 1..294 1553 90.7 Plus
Cpr49Ac-PG 315 CG8502-PG 1..315 1..294 1533 91.1 Plus
Cpr49Ac-PF 315 CG8502-PF 1..315 1..294 1533 91.1 Plus
Cpr49Ac-PE 285 CG8502-PE 1..285 1..294 1531 96.9 Plus
Cpr49Ac-PD 123 CG8502-PD 1..93 1..93 524 100 Plus
Cpr49Ab-PA 259 CG30042-PA 61..256 38..222 188 31.4 Plus
Cpr65Eb-PA 179 CG8638-PA 38..136 138..238 160 32.4 Plus
Cpr49Aa-PB 144 CG30045-PB 34..125 133..217 155 39.1 Plus
Pcp-PA 184 CG3440-PA 27..113 127..217 146 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19056-PA 325 GI19056-PA 1..302 1..265 897 65.6 Plus
Dmoj\GI19054-PA 279 GI19054-PA 186..279 133..223 201 45.7 Plus
Dmoj\GI12346-PA 108 GI12346-PA 15..97 135..218 149 35.6 Plus
Dmoj\GI19053-PA 141 GI19053-PA 29..105 132..203 149 42.9 Plus
Dmoj\GI12347-PA 159 GI12347-PA 38..116 138..216 144 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11632-PA 371 GL11632-PA 45..330 9..265 930 67.8 Plus
Dper\GL11630-PA 271 GL11630-PA 173..268 133..222 180 44.8 Plus
Dper\GL15560-PA 102 GL15560-PA 24..99 132..203 141 40.8 Plus
Dper\GL11748-PA 122 GL11748-PA 20..111 127..218 140 34.4 Plus
Dper\GL11629-PA 149 GL11629-PA 37..147 133..232 140 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15599-PA 264 GA15599-PA 166..261 133..222 181 44.8 Plus
Dpse\GA21228-PA 183 GA21228-PA 42..121 138..217 144 34.5 Plus
Dpse\GA23698-PA 190 GA23698-PA 42..121 138..217 142 34.5 Plus
Dpse\GA20238-PA 102 GA20238-PA 24..99 132..203 140 40.8 Plus
Dpse\GA14899-PA 122 GA14899-PA 20..111 127..218 140 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21376-PA 324 GM21376-PA 1..324 1..294 1213 87 Plus
Dsec\GM21374-PA 259 GM21374-PA 161..256 133..222 177 41.7 Plus
Dsec\GM13790-PA 179 GM13790-PA 38..116 138..216 149 37.3 Plus
Dsec\GM22355-PA 120 GM22355-PA 20..112 126..217 146 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10873-PA 253 GD10873-PA 1..253 1..294 742 61.1 Plus
Dsim\GD10871-PA 220 GD10871-PA 70..195 80..203 158 34.6 Plus
Dsim\GD13091-PA 179 GD13091-PA 38..116 138..216 149 37.3 Plus
Dsim\GD23446-PA 184 GD23446-PA 27..113 127..217 143 33 Plus
Dsim\GD14949-PA 120 GD14949-PA 20..112 126..217 141 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20025-PA 329 GJ20025-PA 1..301 1..265 929 66.4 Plus
Dvir\GJ20023-PA 273 GJ20023-PA 147..273 99..223 218 39.1 Plus
Dvir\GJ20022-PA 173 GJ20022-PA 61..137 132..203 152 42.9 Plus
Dvir\GJ12238-PA 160 GJ12238-PA 38..119 138..219 146 36 Plus
Dvir\GJ12237-PA 123 GJ12237-PA 30..113 135..219 144 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22929-PA 331 GK22929-PA 1..297 1..265 962 71.5 Plus
Dwil\GK22927-PA 251 GK22927-PA 8..226 16..203 181 30.6 Plus
Dwil\GK17540-PA 191 GK17540-PA 41..131 141..230 146 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12450-PA 300 GE12450-PA 1..300 1..294 1081 87 Plus
Dyak\GE12448-PA 258 GE12448-PA 160..233 133..203 166 47.3 Plus
Dyak\GE20445-PA 172 GE20445-PA 39..117 138..216 146 37.3 Plus
Dyak\GE21770-PA 122 GE21770-PA 20..111 126..218 144 33.3 Plus
Dyak\GE14297-PA 185 GE14297-PA 28..114 127..217 142 33 Plus

LP07813.hyp Sequence

Translation from 78 to 962

> LP07813.hyp
MFTKSMLSFSLVVALFVVCHASPVPDNNGRSGSQESIGRYHHMPIPYRHV
SDQRELGKYHHIPYPYDGGYGPYAGSNIPYVHDDRPYNHDLYTSTTTKKP
TTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILHKEEVRKQDKYDHSYL
TENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQG
DHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLKAQIKAI
HLEEMPKELTEQIHMLEHEVELAEEEEREEQAALERLRQAAKSH*

LP07813.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ac-PA 294 CG8502-PA 1..294 1..294 1594 100 Plus
Cpr49Ac-PC 324 CG8502-PC 1..324 1..294 1553 90.7 Plus
Cpr49Ac-PG 315 CG8502-PG 1..315 1..294 1533 91.1 Plus
Cpr49Ac-PF 315 CG8502-PF 1..315 1..294 1533 91.1 Plus
Cpr49Ac-PE 285 CG8502-PE 1..285 1..294 1531 96.9 Plus