Clone LP07818 Report

Search the DGRC for LP07818

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:78
Well:18
Vector:pOT2
Associated Gene/TranscriptCG7715-RA
Protein status:LP07818.pep: gold
Sequenced Size:906

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7715-ra 2011-07-21 Manual selection by Sue Celniker

Clone Sequence Records

LP07818.complete Sequence

906 bp assembled on 2011-12-02

GenBank Submission: BT132890.1

> LP07818.complete
GATAACCAAACGGACGCAGCCCAGAGATGAAAGTATTCGCATTGTGCTTC
TTGAGCCTGCTGGCTTTGAGCCAGGCCCGCTTGGACTACACGCTGCAGTG
CGCCCGCGGTGAGATCAGTATCCGCTGGCCCAGCTACCACAGCAACTCGG
AGTACTATGTGTGCCCGAGCGTCTACGGCAGCCAGTTGACTGTCCACTGT
CCGGCCGGCCAGGTCTTCACCTTTGTCCTCCAGAAGTGCGTGTCGCCAGC
CCACTATATCCCAGCTCCCTCAATGGAAGTCCTGCCCACCGCTGCTCCCA
TCACCATGCAGGTTATCGAGAATGCACCACCAGTGATCTCCGCACTGTCT
CAGCCAGAGGCCGAGACTCCGGAGCACCATGAGCATCAGGAGCACCACGA
GCATAATGAGGAGGAGGTTGAGGCACACCCCATCCCACCAACCCCGGCCC
CAGAGCCACCAACCCCACCCACCGTTGCTATTAAGCCAGCTGTGCCCGTG
CCCGGCAAGAAGGTCACGGTCCCCCAGCCCGGCAAGAAGGCCACCGTTCC
TGTGCCCTCCAAGGCAGCCATGGCGAAGAAGCCCAGCGCCGCTCCCAAGA
AGCCAGCTGCTCCGACTCCATCCAAGGCCGCCAAGAAGCCAACGCCACCC
AGCAAGGCCCAGAAGAAGCCAGCCACCGCTTAAATCCCAATCCCAATCCT
AACCAAGATCGCCAGTTCAATGCCCATCTTTCAGCAAGCGGAATTTCATT
CACTACTCTAAATAGCAATCTAAAGTAATTAAATATCTAACTGGCAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

LP07818.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14551673..14552436 795..32 3760 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18727571..18728336 797..32 3830 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18468402..18469167 797..32 3830 100 Minus
3R 31820162 3R 18469239..18469271 33..1 165 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:55:30 has no hits.

LP07818.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:56:38 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14551673..14552434 34..795 99 <- Minus
chr3R 14552508..14552540 1..33 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-02 15:47:11 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 1..657 27..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:28 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 1..657 27..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:45:53 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 1..657 27..683 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-02 15:47:10 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 29..823 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:28 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 29..823 1..795 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:45:53 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
CG7715-RA 29..823 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:38 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18727573..18728334 34..795 100 <- Minus
3R 18728408..18728440 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:38 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18727573..18728334 34..795 100 <- Minus
3R 18728408..18728440 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:38 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18727573..18728334 34..795 100 <- Minus
3R 18728408..18728440 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:28 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14553295..14554056 34..795 100 <- Minus
arm_3R 14554130..14554162 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:45:53 Download gff for LP07818.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18468404..18469165 34..795 100 <- Minus
3R 18469239..18469271 1..33 100   Minus

LP07818.hyp Sequence

Translation from 26 to 682

> LP07818.hyp
MKVFALCFLSLLALSQARLDYTLQCARGEISIRWPSYHSNSEYYVCPSVY
GSQLTVHCPAGQVFTFVLQKCVSPAHYIPAPSMEVLPTAAPITMQVIENA
PPVISALSQPEAETPEHHEHQEHHEHNEEEVEAHPIPPTPAPEPPTPPTV
AIKPAVPVPGKKVTVPQPGKKATVPVPSKAAMAKKPSAAPKKPAAPTPSK
AAKKPTPPSKAQKKPATA*

LP07818.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7715-PA 218 CG7715-PA 1..218 1..218 1163 100 Plus

LP07818.pep Sequence

Translation from 26 to 682

> LP07818.pep
MKVFALCFLSLLALSQARLDYTLQCARGEISIRWPSYHSNSEYYVCPSVY
GSQLTVHCPAGQVFTFVLQKCVSPAHYIPAPSMEVLPTAAPITMQVIENA
PPVISALSQPEAETPEHHEHQEHHEHNEEEVEAHPIPPTPAPEPPTPPTV
AIKPAVPVPGKKVTVPQPGKKATVPVPSKAAMAKKPSAAPKKPAAPTPSK
AAKKPTPPSKAQKKPATA*

LP07818.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17867-PA 231 GF17867-PA 1..113 1..114 425 75.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16344-PA 219 GG16344-PA 1..219 1..218 762 85.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22087-PA 231 GH22087-PA 1..231 1..212 512 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7715-PA 218 CG7715-PA 1..218 1..218 1163 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21957-PA 212 GI21957-PA 1..208 1..217 420 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23110-PA 449 GL23110-PA 36..205 1..145 444 59.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20538-PA 231 GA20538-PA 1..231 1..218 513 53.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18686-PA 218 GM18686-PA 1..218 1..218 1069 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14316-PA 204 GJ14316-PA 1..108 1..108 390 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13549-PA 231 GK13549-PA 1..112 1..112 384 67 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25176-PA 216 GE25176-PA 1..111 1..111 557 91 Plus