Clone LP08087 Report

Search the DGRC for LP08087

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:80
Well:87
Vector:pOT2
Associated Gene/TranscriptCG32762-RA
Protein status:LP08087.pep: gold
Sequenced Size:882

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32762 2003-01-01 Sim4 clustering to Release 3
CG32762 2008-04-29 Release 5.5 accounting
CG32762 2008-08-15 Release 5.9 accounting
CG32762 2008-12-18 5.12 accounting

Clone Sequence Records

LP08087.complete Sequence

882 bp (882 high quality bases) assembled on 2005-08-09

GenBank Submission: BT023830

> LP08087.complete
CCAACTGCCAGCAATCAAGCAAAATGCACAGCCAACAACTGACTTTGATT
TTCGGCATGACCCTCCTGTGGTCAATGGCCAGCGGCACCACCCAACCGCC
GAGCCGACGTCCGCCGGTTACCACCGCCCGCACCACGCCCCGCAATTGCC
CGCTCTTCCCGCAGGTCTGCTCCCAGACAAGTCCCAGAGTTTGCGGACGA
ACTGCGCGTGGCGAGTGCCAACGTTTCGAGAACATCTGCCACCTGATGCT
GGCCAATGTGCTACGGCAGCCGGAGGGCGTGCGGCACACCCGCGACATCG
ATTGCCGCAACGTGAGGGGAACGGGTGCCGCCAATCGGCGACCCTGCTAT
AATCCCTGCCCCGCACGTCCCGTCGTCTGCAAGAGATCACCGCCCAGCCA
GCAAATCTGCGTGCGTAGCAGGGACAACCGGCAGTGCAAGGTGTTGGCCA
ATAGTTGCCAGCTGCGCAACCAGAATTGCCACAGTCAGCCCAGGAACAAC
TGGCTGCGCACCGACAGGCGGCGTTGTGGACAGCTGCAGCTGGGCGATAA
GCCGCAGAATTGCATCCGGGTGCCAGTGCGGCCCAGACCCACACGTGCGC
AGCACCACTCGACGCAGCACTACTAGGCGCAGCACCACTCGACGCAGCAC
CACTAGGCGCAGCAACTCCACAAGCACCACCACCACCGACCGGCCAGCCT
AAAGGATCAGGGACATCGGTGGCCAGACATTACAATTTCTTTTTTTTTTC
TCTCTCTGCCCAACATCCACTGTGCGCAATAAAAGTCATAAATAAACTGC
AAGTTGCGCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP08087.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32762-RA 923 CG32762-RA 110..923 1..814 4070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5393043..5393487 498..54 2225 100 Minus
chrX 22417052 chrX 5392632..5392945 811..499 1490 99 Minus
chrX 22417052 chrX 5393557..5393611 55..1 275 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5500618..5501062 498..54 2225 100 Minus
X 23542271 X 5500203..5500520 816..499 1590 100 Minus
X 23542271 X 5501132..5501186 55..1 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5508716..5509160 498..54 2225 100 Minus
X 23527363 X 5508301..5508618 816..499 1590 100 Minus
X 23527363 X 5509230..5509284 55..1 275 100 Minus
Blast to na_te.dros performed 2019-03-16 02:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1138..1285 575..718 118 57.3 Plus

LP08087.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:55:57 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5392632..5392945 499..811 99 <- Minus
chrX 5393043..5393486 55..498 100 <- Minus
chrX 5393558..5393611 1..54 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:38:54 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..603 24..626 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:31 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..603 24..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:47 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..603 24..626 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:26:29 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..603 24..626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:50 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..603 24..626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:17 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:31 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:47 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..811 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:26:29 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 1..754 1..754 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:50 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
CG32762-RA 12..822 1..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:57 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
X 5500208..5500520 499..811 100 <- Minus
X 5500618..5501061 55..498 100 <- Minus
X 5501133..5501186 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:57 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
X 5500208..5500520 499..811 100 <- Minus
X 5500618..5501061 55..498 100 <- Minus
X 5501133..5501186 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:57 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
X 5500208..5500520 499..811 100 <- Minus
X 5500618..5501061 55..498 100 <- Minus
X 5501133..5501186 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:47 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5394241..5394553 499..811 100 <- Minus
arm_X 5394651..5395094 55..498 100 <- Minus
arm_X 5395166..5395219 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:59:29 Download gff for LP08087.complete
Subject Subject Range Query Range Percent Splice Strand
X 5508306..5508618 499..811 100 <- Minus
X 5508716..5509159 55..498 100 <- Minus
X 5509231..5509284 1..54 100   Minus

LP08087.hyp Sequence

Translation from 2 to 625

> LP08087.hyp
NCQQSSKMHSQQLTLIFGMTLLWSMASGTTQPPSRRPPVTTARTTPRNCP
LFPQVCSQTSPRVCGRTARGECQRFENICHLMLANVLRQPEGVRHTRDID
CRNVRGTGAANRRPCYNPCPARPVVCKRSPPSQQICVRSRDNRQCKVLAN
SCQLRNQNCHSQPRNNWLRTDRRRCGQLQLGDKPQNCIRVPVRPRPTRAQ
HHSTQHY*

LP08087.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32762-PB 200 CG32762-PB 1..200 8..207 1116 100 Plus
CG32762-PA 200 CG32762-PA 1..200 8..207 1116 100 Plus

LP08087.pep Sequence

Translation from 23 to 625

> LP08087.pep
MHSQQLTLIFGMTLLWSMASGTTQPPSRRPPVTTARTTPRNCPLFPQVCS
QTSPRVCGRTARGECQRFENICHLMLANVLRQPEGVRHTRDIDCRNVRGT
GAANRRPCYNPCPARPVVCKRSPPSQQICVRSRDNRQCKVLANSCQLRNQ
NCHSQPRNNWLRTDRRRCGQLQLGDKPQNCIRVPVRPRPTRAQHHSTQHY
*

LP08087.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21194-PA 244 GF21194-PA 1..187 1..181 601 63.8 Plus
Dana\GF22158-PA 199 GF22158-PA 44..191 39..187 477 62.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18495-PA 207 GG18495-PA 1..186 1..185 838 86.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12865-PA 197 GH12865-PA 20..183 30..186 372 50.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32762-PB 200 CG32762-PB 1..200 1..200 1116 100 Plus
CG32762-PA 200 CG32762-PA 1..200 1..200 1116 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14961-PA 218 GI14961-PA 1..185 4..186 332 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16557-PA 219 GL16557-PA 1..178 1..174 526 61 Plus
Dper\GL16541-PA 207 GL16541-PA 1..187 6..192 377 42.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17120-PA 208 GA17120-PA 1..187 1..183 556 60.7 Plus
Dpse\GA23090-PA 202 GA23090-PA 1..198 1..192 407 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12643-PA 214 GM12643-PA 1..192 1..192 935 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16258-PA 159 GD16258-PA 1..78 1..78 370 89.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18926-PA 228 GJ18926-PA 49..197 45..189 397 53.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20030-PA 210 GK20030-PA 4..164 5..175 487 57.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16811-PA 220 GE16811-PA 1..192 1..188 744 80.2 Plus