LP08443.complete Sequence
577 bp (577 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119070
> LP08443.complete
TGAAGATGCGTTGCCAATTCGTTATCGCCTTTGGGCTTTTGGCCCTAATA
GCAACTGCCTACGCCGATTCTCCACCTGCGGCAGGATCCCCACCCGCGTC
ATCTCCACCGGCTGGAACCCCAACCTCGCCACCTCCAGCGACTGGAACAC
CGCCCTCACCATCCCCAGCGACTGGAACACCACCTTCAGCATCCCCAGCT
GCTGGTACACCGACCTCGCCAACTCCAGCGACTGGAACACCGTCCTCGCC
AGCTACTCCTGATGCGCCCGCTTCCTCGACATCACCAGCTACGCCCACAT
CGCCCAGTGACAGTGGATCCAGCAGCAGCCAGGAAGTGATTAGGCTCAGG
CGTCGGCTGCGCCGGCTGAGGCGTCAGCTCCGCCGCGAGAGGCGTCAGGC
CAACCAGAGTAATCAGAATGGAGGTGGTGGTCAGGGGCGAGTGGTTCGCC
GTGTACACCGTCACCGTCGTCTATTGTAAAATTCACGAACATGTTGGCTA
CGAATTTGAAATAAAATTCCAGACAGAAATGCAATAAATCTAAAAAAAAC
ATAAAAAAAAAAAAAAAAAAAAAAAAA
LP08443.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:01:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11300-RA | 554 | CG11300-RA | 1..554 | 1..554 | 2770 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:18:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 19638092..19638640 | 1..552 | 2575 | 98.2 | Plus |
chr2R | 21145070 | chr2R | 19638200..19638342 | 79..221 | 265 | 79 | Plus |
chr2R | 21145070 | chr2R | 19638170..19638312 | 109..251 | 235 | 77.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23751944..23752498 | 1..555 | 2775 | 100 | Plus |
2R | 25286936 | 2R | 23752022..23752164 | 109..251 | 250 | 78.3 | Plus |
2R | 25286936 | 2R | 23752052..23752194 | 79..221 | 250 | 78.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 23753143..23753697 | 1..555 | 2775 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:18:29 has no hits.
LP08443.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:19:11 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 19638092..19638640 | 1..552 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:05 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..474 | 6..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:08 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..474 | 6..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:18:31 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..474 | 6..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:16 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..474 | 6..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:33 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..474 | 6..479 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:22 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..552 | 1..552 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:08 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 30..581 | 1..552 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:18:31 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 30..581 | 1..552 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:16 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 1..552 | 1..552 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:33 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11300-RA | 30..581 | 1..552 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23751944..23752495 | 1..552 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23751944..23752495 | 1..552 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23751944..23752495 | 1..552 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:18:31 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19639467..19640018 | 1..552 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:35 Download gff for
LP08443.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23753161..23753712 | 1..552 | 100 | | Plus |
LP08443.hyp Sequence
Translation from 2 to 478
> LP08443.hyp
KMRCQFVIAFGLLALIATAYADSPPAAGSPPASSPPAGTPTSPPPATGTP
PSPSPATGTPPSASPAAGTPTSPTPATGTPSSPATPDAPASSTSPATPTS
PSDSGSSSSQEVIRLRRRLRRLRRQLRRERRQANQSNQNGGGGQGRVVRR
VHRHRRLL*
LP08443.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11300-PA | 157 | CG11300-PA | 1..157 | 2..158 | 812 | 100 | Plus |
CG34105-PA | 157 | CG34105-PA | 1..155 | 2..153 | 242 | 38.1 | Plus |
CG12491-PA | 157 | CG12491-PA | 1..155 | 2..153 | 242 | 38.1 | Plus |
CG13560-PB | 181 | CG13560-PB | 1..174 | 2..138 | 198 | 35.4 | Plus |
CG13560-PA | 181 | CG13560-PA | 1..174 | 2..138 | 198 | 35.4 | Plus |
LP08443.pep Sequence
Translation from 5 to 478
> LP08443.pep
MRCQFVIAFGLLALIATAYADSPPAAGSPPASSPPAGTPTSPPPATGTPP
SPSPATGTPPSASPAAGTPTSPTPATGTPSSPATPDAPASSTSPATPTSP
SDSGSSSSQEVIRLRRRLRRLRRQLRRERRQANQSNQNGGGGQGRVVRRV
HRHRRLL*
LP08443.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11300-PA | 157 | CG11300-PA | 1..157 | 1..157 | 812 | 100 | Plus |
CG12491-PA | 157 | CG12491-PA | 1..155 | 1..152 | 242 | 38.1 | Plus |
CG34105-PA | 157 | CG34105-PA | 1..155 | 1..152 | 242 | 38.1 | Plus |
CG13560-PB | 181 | CG13560-PB | 1..174 | 1..137 | 198 | 35.4 | Plus |
CG13560-PA | 181 | CG13560-PA | 1..174 | 1..137 | 198 | 35.4 | Plus |
nol-PA | 130 | CG32077-PA | 1..130 | 1..136 | 160 | 30.8 | Plus |
CG14850-PA | 158 | CG14850-PA | 1..153 | 1..155 | 156 | 32.5 | Plus |
CG14852-PA | 174 | CG14852-PA | 7..168 | 6..156 | 155 | 33.5 | Plus |
CG14265-PB | 119 | CG14265-PB | 19..119 | 45..140 | 138 | 40.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:48:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16044-PA | 162 | GM16044-PA | 1..118 | 1..112 | 216 | 73 | Plus |