Clone LP08443 Report

Search the DGRC for LP08443

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:43
Vector:pOT2
Associated Gene/TranscriptCG11300-RA
Protein status:LP08443.pep: gold
Preliminary Size:555
Sequenced Size:577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11300 2002-01-01 Sim4 clustering to Release 2
CG11300 2002-05-18 Blastp of sequenced clone
CG11300 2003-01-01 Sim4 clustering to Release 3
CG11300 2008-04-29 Release 5.5 accounting
CG11300 2008-08-15 Release 5.9 accounting
CG11300 2008-12-18 5.12 accounting

Clone Sequence Records

LP08443.complete Sequence

577 bp (577 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119070

> LP08443.complete
TGAAGATGCGTTGCCAATTCGTTATCGCCTTTGGGCTTTTGGCCCTAATA
GCAACTGCCTACGCCGATTCTCCACCTGCGGCAGGATCCCCACCCGCGTC
ATCTCCACCGGCTGGAACCCCAACCTCGCCACCTCCAGCGACTGGAACAC
CGCCCTCACCATCCCCAGCGACTGGAACACCACCTTCAGCATCCCCAGCT
GCTGGTACACCGACCTCGCCAACTCCAGCGACTGGAACACCGTCCTCGCC
AGCTACTCCTGATGCGCCCGCTTCCTCGACATCACCAGCTACGCCCACAT
CGCCCAGTGACAGTGGATCCAGCAGCAGCCAGGAAGTGATTAGGCTCAGG
CGTCGGCTGCGCCGGCTGAGGCGTCAGCTCCGCCGCGAGAGGCGTCAGGC
CAACCAGAGTAATCAGAATGGAGGTGGTGGTCAGGGGCGAGTGGTTCGCC
GTGTACACCGTCACCGTCGTCTATTGTAAAATTCACGAACATGTTGGCTA
CGAATTTGAAATAAAATTCCAGACAGAAATGCAATAAATCTAAAAAAAAC
ATAAAAAAAAAAAAAAAAAAAAAAAAA

LP08443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11300-RA 554 CG11300-RA 1..554 1..554 2770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19638092..19638640 1..552 2575 98.2 Plus
chr2R 21145070 chr2R 19638200..19638342 79..221 265 79 Plus
chr2R 21145070 chr2R 19638170..19638312 109..251 235 77.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23751944..23752498 1..555 2775 100 Plus
2R 25286936 2R 23752022..23752164 109..251 250 78.3 Plus
2R 25286936 2R 23752052..23752194 79..221 250 78.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23753143..23753697 1..555 2775 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:18:29 has no hits.

LP08443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:19:11 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19638092..19638640 1..552 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:05 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..474 6..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:08 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..474 6..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:18:31 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..474 6..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:16 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..474 6..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:33 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..474 6..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:22 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..552 1..552 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:08 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 30..581 1..552 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:18:31 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 30..581 1..552 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:16 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 1..552 1..552 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:33 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
CG11300-RA 30..581 1..552 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23751944..23752495 1..552 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23751944..23752495 1..552 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:11 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23751944..23752495 1..552 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:18:31 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19639467..19640018 1..552 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:35 Download gff for LP08443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23753161..23753712 1..552 100   Plus

LP08443.hyp Sequence

Translation from 2 to 478

> LP08443.hyp
KMRCQFVIAFGLLALIATAYADSPPAAGSPPASSPPAGTPTSPPPATGTP
PSPSPATGTPPSASPAAGTPTSPTPATGTPSSPATPDAPASSTSPATPTS
PSDSGSSSSQEVIRLRRRLRRLRRQLRRERRQANQSNQNGGGGQGRVVRR
VHRHRRLL*

LP08443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11300-PA 157 CG11300-PA 1..157 2..158 812 100 Plus
CG34105-PA 157 CG34105-PA 1..155 2..153 242 38.1 Plus
CG12491-PA 157 CG12491-PA 1..155 2..153 242 38.1 Plus
CG13560-PB 181 CG13560-PB 1..174 2..138 198 35.4 Plus
CG13560-PA 181 CG13560-PA 1..174 2..138 198 35.4 Plus

LP08443.pep Sequence

Translation from 5 to 478

> LP08443.pep
MRCQFVIAFGLLALIATAYADSPPAAGSPPASSPPAGTPTSPPPATGTPP
SPSPATGTPPSASPAAGTPTSPTPATGTPSSPATPDAPASSTSPATPTSP
SDSGSSSSQEVIRLRRRLRRLRRQLRRERRQANQSNQNGGGGQGRVVRRV
HRHRRLL*

LP08443.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11300-PA 157 CG11300-PA 1..157 1..157 812 100 Plus
CG12491-PA 157 CG12491-PA 1..155 1..152 242 38.1 Plus
CG34105-PA 157 CG34105-PA 1..155 1..152 242 38.1 Plus
CG13560-PB 181 CG13560-PB 1..174 1..137 198 35.4 Plus
CG13560-PA 181 CG13560-PA 1..174 1..137 198 35.4 Plus
nol-PA 130 CG32077-PA 1..130 1..136 160 30.8 Plus
CG14850-PA 158 CG14850-PA 1..153 1..155 156 32.5 Plus
CG14852-PA 174 CG14852-PA 7..168 6..156 155 33.5 Plus
CG14265-PB 119 CG14265-PB 19..119 45..140 138 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16044-PA 162 GM16044-PA 1..118 1..112 216 73 Plus