Clone LP08456 Report

Search the DGRC for LP08456

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:56
Vector:pOT2
Associated Gene/TranscriptCG5011-RA
Protein status:LP08456.pep: Inserted from web LP08456.pep2: Inserted from web
Preliminary Size:1196
Sequenced Size:1002

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5011 2001-01-01 Release 2 assignment
CG5011 2003-01-01 Sim4 clustering to Release 3
CG5011 2008-04-29 Release 5.5 accounting
CG5011 2008-08-15 Release 5.9 accounting
CG5011 2008-12-18 5.12 accounting

Clone Sequence Records

LP08456.complete Sequence

1002 bp (1002 high quality bases) assembled on 2020-02-20

GenBank Submission: AY069746

> LP08456.complete
AAGATGCCACCTCCACCGCACCACGACCACCACCATCATCATGGGCCACC
ACACCATGGACCTCCCCACCATGGGCCACCGCACCATGGTCCTCCACACC
ACGGGCCACCGCATCACGGGCCACCACACCACGGACCGCCGCACCATGGA
CCTCCGCACCACGACCACCATCATCATGGACCACCACACCACGGTCCTCC
AATGCATCCTCGATGAGAACTATAATACAATATAAGCCGAATTTAACGTT
ATAAACTGATATGGAAAAACTTAATCGTTAACTGTGATTAAGCCACAAAC
TAACATTAAAATATCTTCACTAACTTCTAGTTAGTTTCACCAAGAGCAAA
ATGTTTTTATTTTAGAAATTGTTTAATTTTATAACACCATTATAAAGATA
CTGATTCTAATAAGCAATTAGAAGAATATTGAAGCAAGAATTGATTAAGT
ATGATTAAGTATCAAAAAGCCAGCAGATAAGGTAGACAATTATATATAAA
AGAAAGTCCCTCTCCACTAGAATGCAGATAAGATTACAGCCTACTGAAAC
TATGTTACTTTTGTATAAAAGGTCTGGCAGGAGTGAGCCAGTTTAGTGTA
CAACAGAAGCCCGCCAAGCAAAGATGCCTCCTCCACCACCGCACCACCAC
CACAACCCGCCGCCTCATGGGCCACCGCCCCACGGACCACCGCACCATGG
ACCTCCGCACCATGAACCACAGCCCCCGTTCCACACGCCAGTGCATCCGA
TTTACCACGAACCTCCTCACGGAAACAGCTCCGGCTACAATCCTCCGCCG
CCGCATGGTCCGTATCCATATGGTCCAGGATACGTGGCCCCAGGACCTCC
AATGCATCCGCGATAAGAACTGAACTGTAATCTAGATCGGTTAATATAGT
GTGATATCAACAAATGTACATTTGTGTGTGATTAAAAAATATGCTGCTTT
TAAATATATAAACTAACTTTAGTTAGTCACGCCTAAAAAAAAAAAAAAAA
AA

LP08456.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RA 984 CG5011-RA 1..984 1..984 4920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2020-02-20 10:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1200186..1201169 1..984 4830 99.4 Plus
chr2L 23010047 chr2L 1200294..1200346 660..712 190 90.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:52:49 has no hits.
Blast to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RB 550 CG5011-RB 1..550 435..984 2750 100 Plus
CG5011-RA 443 CG5011-RA 1..443 542..984 2215 100 Plus
CG43349-RB 459 CG43349-RB 33..459 1..427 2135 100 Plus
CG43349-RB 459 CG43349-RB 141..193 660..712 190 90.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2020-02-20 10:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1200237..1201221 1..985 4925 100 Plus
2L 23513712 2L 1200345..1200397 660..712 190 90.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1200237..1201221 1..985 4925 100 Plus
Blast to na_te.dros performed 2020-02-20 10:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6719..6867 301..451 155 59.5 Plus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2583..2712 345..467 138 62.1 Plus
gypsy4 6852 gypsy4 GYPSY4 6852bp 2133..2282 320..466 122 56.6 Plus
412 7567 412 412 7567bp 3966..4078 458..347 113 61.9 Minus
HB 1653 HB DMTHB1 1653bp Derived from X01748 (g8693) (Rel. 49, Last updated, Version 3). 289..348 971..912 111 65 Minus
TAHRE 10463 TAHRE OSV 10463bp 6017..6110 406..499 110 61.9 Plus

LP08456.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2020-02-20 10:20:32 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1200186..1201169 1..984 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:08 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 624..866 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:38 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 624..866 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:05:17 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 624..866 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:05 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 624..866 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:18 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 624..866 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:55:20 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..984 1..984 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:37 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..984 1..984 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:17 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RB 1..550 435..984 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:05 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..984 1..984 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:18 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RB 1..550 435..984 100   Plus
Sim4 to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:20:32 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RB 1..550 435..984 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:20:32 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1200237..1201220 1..984 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:20:32 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1200237..1201220 1..984 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:17 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1200237..1201220 1..984 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:05 Download gff for LP08456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1200237..1201220 1..984 100   Plus

LP08456.hyp Sequence

Translation from 2 to 253

> LP08456.hyp
DATSTAPRPPPSSWATTPWTSPPWATAPWSSTPRATASRATTPRTAAPWT
SAPRPPSSWTTTPRSSNASSMRTIIQYKPNLTL*
Sequence LP08456.hyp has no blast hits.

LP08456.pep2 Sequence

Translation from 3 to 215

> LP08456.pep2
MPPPPHHDHHHHHGPPHHGPPHHGPPHHGPPHHGPPHHGPPHHGPPHHGP
PHHDHHHHGPPHHGPPMHPR*

LP08456.pep2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2022-04-26 23:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43349-PB 70 CG43349-PB 1..70 1..70 502 100 Plus
CG43349-PA 70 CG43349-PA 1..70 1..70 502 100 Plus
CG5011-PB 80 CG5011-PB 1..80 1..70 242 56.6 Plus
CG5011-PA 80 CG5011-PA 1..80 1..70 242 56.6 Plus
CG13482-PA 102 CG13482-PA 40..100 2..68 204 58.2 Plus
CG13482-PA 102 CG13482-PA 24..84 6..64 202 58.5 Plus
CG13482-PA 102 CG13482-PA 3..75 4..68 183 47.6 Plus
ssx-PE 443 CG3056-PE 292..375 1..69 177 43.7 Plus
ssx-PB 443 CG3056-PB 292..375 1..69 177 43.7 Plus
ssx-PD 485 CG3056-PD 292..375 1..69 177 43.7 Plus
CG15126-PA 53 CG15126-PA 3..43 15..60 172 70.2 Plus
CG15126-PA 53 CG15126-PA 1..43 1..50 168 64.7 Plus
CG15126-PA 53 CG15126-PA 3..39 20..63 156 63.6 Plus
CG5225-PA 594 CG5225-PA 317..384 2..68 156 45.8 Plus
CG5225-PA 594 CG5225-PA 341..409 2..68 152 41.7 Plus
CG15126-PA 53 CG15126-PA 3..39 25..68 147 61.4 Plus
pygo-PA 815 CG11518-PA 586..684 5..67 147 38.6 Plus
CG5225-PA 594 CG5225-PA 129..229 1..69 146 37.9 Plus
Catsup-PA 449 CG10449-PA 60..114 5..59 143 48.2 Plus
CG44838-PF 783 CG44838-PF 646..726 3..69 143 42 Plus
CG44838-PH 783 CG44838-PH 646..726 3..69 143 42 Plus
CG44838-PG 783 CG44838-PG 646..726 3..69 143 42 Plus
CG44838-PD 783 CG44838-PD 646..726 3..69 143 42 Plus
CG15784-PB 554 CG15784-PB 177..238 7..69 140 47.7 Plus
CG15784-PA 554 CG15784-PA 177..238 7..69 140 47.7 Plus
CG5225-PA 594 CG5225-PA 301..368 9..68 138 45.7 Plus
CG15784-PB 554 CG15784-PB 198..257 7..62 137 49.2 Plus
CG15784-PA 554 CG15784-PA 198..257 7..62 137 49.2 Plus
lz-PB 705 CG1689-PB 107..150 9..69 137 45.9 Plus
lz-PA 826 CG1689-PA 107..150 9..69 137 45.9 Plus
ssx-PE 443 CG3056-PE 282..338 14..63 135 49.1 Plus
ssx-PB 443 CG3056-PB 282..338 14..63 135 49.1 Plus
ssx-PD 485 CG3056-PD 282..338 14..63 135 49.1 Plus
Sf3a1-PA 784 CG16941-PA 567..626 2..67 135 40.9 Plus
nito-PC 793 CG2910-PC 190..278 1..69 135 38.9 Plus
nito-PA 793 CG2910-PA 190..278 1..69 135 38.9 Plus
nito-PB 793 CG2910-PB 190..278 1..69 135 38.9 Plus
CG5225-PA 594 CG5225-PA 359..437 4..65 134 44.3 Plus
CG42260-PB 974 CG42260-PB 226..277 9..66 133 48.3 Plus
CG42260-PD 1247 CG42260-PD 501..552 9..66 133 48.3 Plus
CG42260-PA 1249 CG42260-PA 501..552 9..66 133 48.3 Plus
brm-PB 1638 CG5942-PB 29..94 3..69 133 43.5 Plus
brm-PA 1638 CG5942-PA 29..94 3..69 133 43.5 Plus
brm-PE 1658 CG5942-PE 29..94 3..69 133 43.5 Plus
CG14073-PC 2133 CG14073-PC 1..83 1..65 133 38.1 Plus
CG14073-PB 2133 CG14073-PB 1..83 1..65 133 38.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2022-04-26 23:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23086-PA 70 GD23086-PA 1..70 1..70 228 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2022-04-26 23:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17462-PA 69 GE17462-PA 3..69 2..70 207 97.1 Plus

LP08456.pep Sequence

Translation from 623 to 865

> LP08456.pep
MPPPPPHHHHNPPPHGPPPHGPPHHGPPHHEPQPPFHTPVHPIYHEPPHG
NSSGYNPPPPHGPYPYGPGYVAPGPPMHPR*

LP08456.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2022-04-26 23:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-PB 80 CG5011-PB 1..80 1..80 531 100 Plus
CG5011-PA 80 CG5011-PA 1..80 1..80 531 100 Plus
CG43349-PB 70 CG43349-PB 1..70 1..80 242 56.6 Plus
CG43349-PA 70 CG43349-PA 1..70 1..80 242 56.6 Plus
CG13482-PA 102 CG13482-PA 31..96 2..62 151 44.9 Plus
CG5225-PA 594 CG5225-PA 155..232 2..79 150 42.5 Plus
Bap111-PA 749 CG7055-PA 565..657 1..76 141 34.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2022-04-26 23:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23087-PA 85 GD23087-PA 41..85 36..80 124 93.3 Plus