BDGP Sequence Production Resources |
Search the DGRC for LP08842
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 88 |
Well: | 42 |
Vector: | pOT2 |
Associated Gene/Transcript | Npc2f-RA |
Protein status: | LP08842.pep: gold |
Preliminary Size: | 913 |
Sequenced Size: | 730 |
Gene | Date | Evidence |
---|---|---|
CG6164 | 2001-01-01 | Release 2 assignment |
CG6164 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6164 | 2003-01-14 | Blastp of sequenced clone |
CG6164 | 2008-04-29 | Release 5.5 accounting |
CG6164 | 2008-08-15 | Release 5.9 accounting |
CG6164 | 2008-12-18 | 5.12 accounting |
730 bp (730 high quality bases) assembled on 2003-01-14
GenBank Submission: AY061552
> LP08842.complete GCAAATCGTATCGCCAAAAAAAAACGTTGCCAGCCCGTGATCCTGATTAA CGAACTGCTTTGTTATTGTTATTAACATTTCTTATTTGCACACCTACGCA AAATTCGTTTGGACGATATTCTAATCAAACCGCGATCAAGATCTCAGTCG ATTAAACCATGCGCGGCGCCCTAATGGATTACTATCTAAAAATACTCTTG GTTATTTGCGCTGCCCACGAATTGGCCGGCGGAACGATCAAGTCTACCAG AGATGCTGTTTACAAAAAATATCTGTCCCTAAGATCTTTGCCCTTCGAGG ATTGCGGTTCTTTGTACCAGGTCAGCTACCTGGACATCGAGAGCTGTACG ACACTGCCCTGCTCCATGGCCCGGAACGCGACAATTAAGGTTACTGTGCG CTTCGATGATAATGGCAATGGCGTCAGCTTTCTGAAGCACGAAGTCCGAT GGGTGTTTAACTACATCAAGACCCAGGCGGCCATAACTCCCGATCCCTGC GACGGAGATCACGGATGCATAGAGAGCGCAAGTGGTGGAAAGGCCTATTG GGCCAATATCTTTGTGAACGAAACTTTGCCGGTGATGAAAGGTAGCATGT TGTGGGAATCCAAGGATGCGAACGATCAGAACCTAATCTGTTTCCAGGTT CCCGTTGTAATCACAGTGTAAATGTGTAATCACGAAAATAAAGTAATTGG TGCATGCAAATCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2f-RA | 1072 | Npc2f-RA | 279..992 | 1..714 | 3570 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 19961225..19961529 | 1..308 | 1460 | 99 | Plus |
chr3R | 27901430 | chr3R | 19963853..19964023 | 414..584 | 840 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 19964135..19964263 | 584..712 | 645 | 100 | Plus |
chr3R | 27901430 | chr3R | 19963105..19963214 | 306..415 | 550 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 24137895..24138202 | 1..308 | 1540 | 100 | Plus |
3R | 32079331 | 3R | 24140526..24140696 | 414..584 | 855 | 100 | Plus |
3R | 32079331 | 3R | 24140808..24140938 | 584..714 | 655 | 100 | Plus |
3R | 32079331 | 3R | 24139778..24139887 | 306..415 | 550 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 23878726..23879033 | 1..308 | 1540 | 100 | Plus |
3R | 31820162 | 3R | 23881357..23881527 | 414..584 | 855 | 100 | Plus |
3R | 31820162 | 3R | 23881639..23881769 | 584..714 | 655 | 100 | Plus |
3R | 31820162 | 3R | 23880609..23880718 | 306..415 | 550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19961225..19961527 | 1..306 | 99 | -> | Plus |
chr3R | 19963106..19963213 | 307..414 | 100 | -> | Plus |
chr3R | 19963854..19964023 | 415..584 | 99 | -> | Plus |
chr3R | 19964136..19964263 | 585..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6164-RA | 1..513 | 159..671 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..513 | 159..671 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..513 | 159..671 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6164-RA | 1..513 | 159..671 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..513 | 159..671 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6164-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6164-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2f-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24137895..24138200 | 1..306 | 100 | -> | Plus |
3R | 24139779..24139886 | 307..414 | 100 | -> | Plus |
3R | 24140527..24140696 | 415..584 | 100 | -> | Plus |
3R | 24140809..24140936 | 585..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24137895..24138200 | 1..306 | 100 | -> | Plus |
3R | 24139779..24139886 | 307..414 | 100 | -> | Plus |
3R | 24140527..24140696 | 415..584 | 100 | -> | Plus |
3R | 24140809..24140936 | 585..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24137895..24138200 | 1..306 | 100 | -> | Plus |
3R | 24139779..24139886 | 307..414 | 100 | -> | Plus |
3R | 24140527..24140696 | 415..584 | 100 | -> | Plus |
3R | 24140809..24140936 | 585..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19966249..19966418 | 415..584 | 100 | -> | Plus |
arm_3R | 19966531..19966658 | 585..712 | 100 | Plus | |
arm_3R | 19963617..19963922 | 1..306 | 100 | -> | Plus |
arm_3R | 19965501..19965608 | 307..414 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23878726..23879031 | 1..306 | 100 | -> | Plus |
3R | 23880610..23880717 | 307..414 | 100 | -> | Plus |
3R | 23881358..23881527 | 415..584 | 100 | -> | Plus |
3R | 23881640..23881767 | 585..712 | 100 | Plus |
Translation from 158 to 670
> LP08842.hyp MRGALMDYYLKILLVICAAHELAGGTIKSTRDAVYKKYLSLRSLPFEDCG SLYQVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVF NYIKTQAAITPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWE SKDANDQNLICFQVPVVITV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2f-PA | 170 | CG6164-PA | 1..170 | 1..170 | 904 | 100 | Plus |
Translation from 158 to 670
> LP08842.pep MRGALMDYYLKILLVICAAHELAGGTIKSTRDAVYKKYLSLRSLPFEDCG SLYQVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVF NYIKTQAAITPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWE SKDANDQNLICFQVPVVITV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16107-PA | 170 | GF16107-PA | 1..170 | 1..170 | 810 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11258-PA | 170 | GG11258-PA | 1..170 | 1..170 | 892 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18496-PA | 169 | GH18496-PA | 1..169 | 1..170 | 667 | 69.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2f-PA | 170 | CG6164-PA | 1..170 | 1..170 | 904 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24170-PA | 169 | GI24170-PA | 1..169 | 1..170 | 654 | 70 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23407-PA | 169 | GL23407-PA | 1..169 | 1..170 | 761 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19402-PA | 169 | GA19402-PA | 1..169 | 1..170 | 757 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26563-PA | 170 | GM26563-PA | 1..170 | 1..170 | 892 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21068-PA | 170 | GD21068-PA | 1..170 | 1..170 | 910 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14203-PA | 169 | GJ14203-PA | 1..168 | 1..169 | 667 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11159-PA | 169 | GK11159-PA | 1..169 | 1..170 | 668 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23450-PA | 170 | GE23450-PA | 1..170 | 1..170 | 902 | 98.8 | Plus |