Clone LP08842 Report

Search the DGRC for LP08842

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:88
Well:42
Vector:pOT2
Associated Gene/TranscriptNpc2f-RA
Protein status:LP08842.pep: gold
Preliminary Size:913
Sequenced Size:730

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6164 2001-01-01 Release 2 assignment
CG6164 2003-01-01 Sim4 clustering to Release 3
CG6164 2003-01-14 Blastp of sequenced clone
CG6164 2008-04-29 Release 5.5 accounting
CG6164 2008-08-15 Release 5.9 accounting
CG6164 2008-12-18 5.12 accounting

Clone Sequence Records

LP08842.complete Sequence

730 bp (730 high quality bases) assembled on 2003-01-14

GenBank Submission: AY061552

> LP08842.complete
GCAAATCGTATCGCCAAAAAAAAACGTTGCCAGCCCGTGATCCTGATTAA
CGAACTGCTTTGTTATTGTTATTAACATTTCTTATTTGCACACCTACGCA
AAATTCGTTTGGACGATATTCTAATCAAACCGCGATCAAGATCTCAGTCG
ATTAAACCATGCGCGGCGCCCTAATGGATTACTATCTAAAAATACTCTTG
GTTATTTGCGCTGCCCACGAATTGGCCGGCGGAACGATCAAGTCTACCAG
AGATGCTGTTTACAAAAAATATCTGTCCCTAAGATCTTTGCCCTTCGAGG
ATTGCGGTTCTTTGTACCAGGTCAGCTACCTGGACATCGAGAGCTGTACG
ACACTGCCCTGCTCCATGGCCCGGAACGCGACAATTAAGGTTACTGTGCG
CTTCGATGATAATGGCAATGGCGTCAGCTTTCTGAAGCACGAAGTCCGAT
GGGTGTTTAACTACATCAAGACCCAGGCGGCCATAACTCCCGATCCCTGC
GACGGAGATCACGGATGCATAGAGAGCGCAAGTGGTGGAAAGGCCTATTG
GGCCAATATCTTTGTGAACGAAACTTTGCCGGTGATGAAAGGTAGCATGT
TGTGGGAATCCAAGGATGCGAACGATCAGAACCTAATCTGTTTCCAGGTT
CCCGTTGTAATCACAGTGTAAATGTGTAATCACGAAAATAAAGTAATTGG
TGCATGCAAATCAAAAAAAAAAAAAAAAAA

LP08842.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2f-RA 1072 Npc2f-RA 279..992 1..714 3570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19961225..19961529 1..308 1460 99 Plus
chr3R 27901430 chr3R 19963853..19964023 414..584 840 99.4 Plus
chr3R 27901430 chr3R 19964135..19964263 584..712 645 100 Plus
chr3R 27901430 chr3R 19963105..19963214 306..415 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24137895..24138202 1..308 1540 100 Plus
3R 32079331 3R 24140526..24140696 414..584 855 100 Plus
3R 32079331 3R 24140808..24140938 584..714 655 100 Plus
3R 32079331 3R 24139778..24139887 306..415 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23878726..23879033 1..308 1540 100 Plus
3R 31820162 3R 23881357..23881527 414..584 855 100 Plus
3R 31820162 3R 23881639..23881769 584..714 655 100 Plus
3R 31820162 3R 23880609..23880718 306..415 550 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:48:50 has no hits.

LP08842.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:49:38 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19961225..19961527 1..306 99 -> Plus
chr3R 19963106..19963213 307..414 100 -> Plus
chr3R 19963854..19964023 415..584 99 -> Plus
chr3R 19964136..19964263 585..712 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:30 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
CG6164-RA 1..513 159..671 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:24 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..513 159..671 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:51 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..513 159..671 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:28 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
CG6164-RA 1..513 159..671 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:55:21 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..513 159..671 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:49 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
CG6164-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:24 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:51 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:28 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
CG6164-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:55:21 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2f-RA 1..712 1..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:38 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24137895..24138200 1..306 100 -> Plus
3R 24139779..24139886 307..414 100 -> Plus
3R 24140527..24140696 415..584 100 -> Plus
3R 24140809..24140936 585..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:38 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24137895..24138200 1..306 100 -> Plus
3R 24139779..24139886 307..414 100 -> Plus
3R 24140527..24140696 415..584 100 -> Plus
3R 24140809..24140936 585..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:38 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24137895..24138200 1..306 100 -> Plus
3R 24139779..24139886 307..414 100 -> Plus
3R 24140527..24140696 415..584 100 -> Plus
3R 24140809..24140936 585..712 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:51 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19966249..19966418 415..584 100 -> Plus
arm_3R 19966531..19966658 585..712 100   Plus
arm_3R 19963617..19963922 1..306 100 -> Plus
arm_3R 19965501..19965608 307..414 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:34 Download gff for LP08842.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23878726..23879031 1..306 100 -> Plus
3R 23880610..23880717 307..414 100 -> Plus
3R 23881358..23881527 415..584 100 -> Plus
3R 23881640..23881767 585..712 100   Plus

LP08842.hyp Sequence

Translation from 158 to 670

> LP08842.hyp
MRGALMDYYLKILLVICAAHELAGGTIKSTRDAVYKKYLSLRSLPFEDCG
SLYQVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVF
NYIKTQAAITPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWE
SKDANDQNLICFQVPVVITV*

LP08842.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2f-PA 170 CG6164-PA 1..170 1..170 904 100 Plus

LP08842.pep Sequence

Translation from 158 to 670

> LP08842.pep
MRGALMDYYLKILLVICAAHELAGGTIKSTRDAVYKKYLSLRSLPFEDCG
SLYQVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVF
NYIKTQAAITPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWE
SKDANDQNLICFQVPVVITV*

LP08842.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16107-PA 170 GF16107-PA 1..170 1..170 810 85.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11258-PA 170 GG11258-PA 1..170 1..170 892 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18496-PA 169 GH18496-PA 1..169 1..170 667 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2f-PA 170 CG6164-PA 1..170 1..170 904 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24170-PA 169 GI24170-PA 1..169 1..170 654 70 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23407-PA 169 GL23407-PA 1..169 1..170 761 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19402-PA 169 GA19402-PA 1..169 1..170 757 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26563-PA 170 GM26563-PA 1..170 1..170 892 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21068-PA 170 GD21068-PA 1..170 1..170 910 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14203-PA 169 GJ14203-PA 1..168 1..169 667 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11159-PA 169 GK11159-PA 1..169 1..170 668 70.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23450-PA 170 GE23450-PA 1..170 1..170 902 98.8 Plus