BDGP Sequence Production Resources |
Search the DGRC for LP09251
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 92 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17721-RA |
Protein status: | LP09251.pep: gold |
Preliminary Size: | 590 |
Sequenced Size: | 621 |
Gene | Date | Evidence |
---|---|---|
CG17721 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17721 | 2002-05-18 | Blastp of sequenced clone |
CG17721 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17721 | 2008-04-29 | Release 5.5 accounting |
CG17721 | 2008-08-15 | Release 5.9 accounting |
CG17721 | 2008-12-18 | 5.12 accounting |
621 bp (621 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119074
> LP09251.complete TTACTTAGGCCAATAGCCAGCGGAAAATGGTCTACGTGAATCTAATAATA GGCTTGGGCCTGGTGTCCGTTGCCGCTTTCGCCTATTTCAATTGGCATAA CGACCGCAGTTCGCCTTACTCCAGGTCGCCGAATGGCAGGTGCACCTTTT GCCAGTATGAACTGAGTGATGACGACCGGCGCCGCATGAGGTGTGGACAT GCCATGCACAATCTCTGCTACTTGGTGTTTCGCTATTCCCATAGAAAGTG CCTCGAGTGCGATAAGGTGGTTAATGTCAATATAGCCGGTGACTTGTGCA CGATTTGTTTAGATCCCCTAAGTGTTTACACCATGGTGTATCTGCGCTGC AGCCACGCCTTGCATGAGAAGTGCCTCCACCAGTACCAGGCTAATGGTGG CCGCCACTGTCCGGTCTGCAGAATGGGAATTAAGGAGTAGGTATCACCTA GTGATCATGCAGCCAGGCAAAGCCATATATCAGCATAAGCGTGCACTTAA TGCAAGGCTCAACGAATTTTATATATAACATTAAGTCGAGAGCAAAGAAG TCTGATTAAGATTTTAGTTCTGAAACGAATAAAAGTTAGATTTCTTAAAA GAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17721-RA | 858 | CG17721-RA | 244..845 | 1..602 | 3010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ivk | 5402 | Ivk IVK 5402bp | 4466..4528 | 348..285 | 111 | 70.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7060960..7061083 | 1..124 | 99 | -> | Plus |
chr3R | 7061178..7061654 | 125..601 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..414 | 27..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RB | 1..414 | 27..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..414 | 27..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..414 | 27..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..414 | 27..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..590 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RB | 1..601 | 1..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 244..844 | 1..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 1..590 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17721-RA | 244..844 | 1..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11235383..11235506 | 1..124 | 100 | -> | Plus |
3R | 11235601..11236077 | 125..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11235383..11235506 | 1..124 | 100 | -> | Plus |
3R | 11235601..11236077 | 125..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11235383..11235506 | 1..124 | 100 | -> | Plus |
3R | 11235601..11236077 | 125..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7061105..7061228 | 1..124 | 100 | -> | Plus |
arm_3R | 7061323..7061799 | 125..601 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10976432..10976908 | 125..601 | 100 | Plus | |
3R | 10976214..10976337 | 1..124 | 100 | -> | Plus |
Translation from 26 to 439
> LP09251.pep MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRSPNGRCTFCQYELSDDD RRRMRCGHAMHNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSV YTMVYLRCSHALHEKCLHQYQANGGRHCPVCRMGIKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16744-PA | 162 | GF16744-PA | 61..158 | 35..132 | 229 | 43.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18023-PA | 141 | GG18023-PA | 1..136 | 1..136 | 330 | 45.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14968-PA | 94 | GH14968-PA | 1..93 | 46..137 | 173 | 38.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17721-PB | 137 | CG17721-PB | 1..137 | 1..137 | 771 | 100 | Plus |
CG17721-PA | 137 | CG17721-PA | 1..137 | 1..137 | 771 | 100 | Plus |
CG17721-PC | 149 | CG17721-PC | 1..149 | 1..137 | 748 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23702-PA | 162 | GI23702-PA | 1..158 | 1..131 | 241 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12573-PA | 91 | GL12573-PA | 1..77 | 1..75 | 151 | 44.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14625-PB | 144 | GA14625-PB | 1..141 | 1..132 | 304 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23930-PA | 91 | GM23930-PA | 1..89 | 1..135 | 228 | 43.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20672-PA | 96 | GD20672-PA | 1..94 | 1..135 | 272 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23260-PA | 120 | GJ23260-PA | 40..116 | 32..106 | 132 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26083-PA | 173 | GE26083-PA | 1..167 | 1..136 | 324 | 41.3 | Plus |
Translation from 26 to 439
> LP09251.hyp MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRSPNGRCTFCQYELSDDD RRRMRCGHAMHNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSV YTMVYLRCSHALHEKCLHQYQANGGRHCPVCRMGIKE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17721-PB | 137 | CG17721-PB | 1..137 | 1..137 | 771 | 100 | Plus |
CG17721-PA | 137 | CG17721-PA | 1..137 | 1..137 | 771 | 100 | Plus |
CG17721-PC | 149 | CG17721-PC | 1..149 | 1..137 | 748 | 91.9 | Plus |