Clone LP09251 Report

Search the DGRC for LP09251

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:92
Well:51
Vector:pOT2
Associated Gene/TranscriptCG17721-RA
Protein status:LP09251.pep: gold
Preliminary Size:590
Sequenced Size:621

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17721 2002-01-01 Sim4 clustering to Release 2
CG17721 2002-05-18 Blastp of sequenced clone
CG17721 2003-01-01 Sim4 clustering to Release 3
CG17721 2008-04-29 Release 5.5 accounting
CG17721 2008-08-15 Release 5.9 accounting
CG17721 2008-12-18 5.12 accounting

Clone Sequence Records

LP09251.complete Sequence

621 bp (621 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119074

> LP09251.complete
TTACTTAGGCCAATAGCCAGCGGAAAATGGTCTACGTGAATCTAATAATA
GGCTTGGGCCTGGTGTCCGTTGCCGCTTTCGCCTATTTCAATTGGCATAA
CGACCGCAGTTCGCCTTACTCCAGGTCGCCGAATGGCAGGTGCACCTTTT
GCCAGTATGAACTGAGTGATGACGACCGGCGCCGCATGAGGTGTGGACAT
GCCATGCACAATCTCTGCTACTTGGTGTTTCGCTATTCCCATAGAAAGTG
CCTCGAGTGCGATAAGGTGGTTAATGTCAATATAGCCGGTGACTTGTGCA
CGATTTGTTTAGATCCCCTAAGTGTTTACACCATGGTGTATCTGCGCTGC
AGCCACGCCTTGCATGAGAAGTGCCTCCACCAGTACCAGGCTAATGGTGG
CCGCCACTGTCCGGTCTGCAGAATGGGAATTAAGGAGTAGGTATCACCTA
GTGATCATGCAGCCAGGCAAAGCCATATATCAGCATAAGCGTGCACTTAA
TGCAAGGCTCAACGAATTTTATATATAACATTAAGTCGAGAGCAAAGAAG
TCTGATTAAGATTTTAGTTCTGAAACGAATAAAAGTTAGATTTCTTAAAA
GAAAAAAAAAAAAAAAAAAAA

LP09251.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17721-RA 858 CG17721-RA 244..845 1..602 3010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7061175..7061654 122..601 2385 99.8 Plus
chr3R 27901430 chr3R 7060960..7061085 1..126 615 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11235598..11236078 122..602 2405 100 Plus
3R 32079331 3R 11235383..11235508 1..126 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10976429..10976909 122..602 2405 100 Plus
3R 31820162 3R 10976214..10976339 1..126 630 100 Plus
Blast to na_te.dros performed 2019-03-16 04:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 4466..4528 348..285 111 70.1 Minus

LP09251.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:37:42 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7060960..7061083 1..124 99 -> Plus
chr3R 7061178..7061654 125..601 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:41 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..414 27..440 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:57 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RB 1..414 27..440 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:36:43 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..414 27..440 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:34:03 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..414 27..440 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:15 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..414 27..440 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:16:08 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:57 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RB 1..601 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:36:43 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 244..844 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:34:03 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:15 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
CG17721-RA 244..844 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:42 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11235383..11235506 1..124 100 -> Plus
3R 11235601..11236077 125..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:42 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11235383..11235506 1..124 100 -> Plus
3R 11235601..11236077 125..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:42 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11235383..11235506 1..124 100 -> Plus
3R 11235601..11236077 125..601 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:36:43 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7061105..7061228 1..124 100 -> Plus
arm_3R 7061323..7061799 125..601 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:23 Download gff for LP09251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10976432..10976908 125..601 100   Plus
3R 10976214..10976337 1..124 100 -> Plus

LP09251.pep Sequence

Translation from 26 to 439

> LP09251.pep
MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRSPNGRCTFCQYELSDDD
RRRMRCGHAMHNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSV
YTMVYLRCSHALHEKCLHQYQANGGRHCPVCRMGIKE*

LP09251.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16744-PA 162 GF16744-PA 61..158 35..132 229 43.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18023-PA 141 GG18023-PA 1..136 1..136 330 45.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14968-PA 94 GH14968-PA 1..93 46..137 173 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG17721-PB 137 CG17721-PB 1..137 1..137 771 100 Plus
CG17721-PA 137 CG17721-PA 1..137 1..137 771 100 Plus
CG17721-PC 149 CG17721-PC 1..149 1..137 748 91.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23702-PA 162 GI23702-PA 1..158 1..131 241 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12573-PA 91 GL12573-PA 1..77 1..75 151 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14625-PB 144 GA14625-PB 1..141 1..132 304 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23930-PA 91 GM23930-PA 1..89 1..135 228 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20672-PA 96 GD20672-PA 1..94 1..135 272 46.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23260-PA 120 GJ23260-PA 40..116 32..106 132 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26083-PA 173 GE26083-PA 1..167 1..136 324 41.3 Plus

LP09251.hyp Sequence

Translation from 26 to 439

> LP09251.hyp
MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRSPNGRCTFCQYELSDDD
RRRMRCGHAMHNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSV
YTMVYLRCSHALHEKCLHQYQANGGRHCPVCRMGIKE*

LP09251.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17721-PB 137 CG17721-PB 1..137 1..137 771 100 Plus
CG17721-PA 137 CG17721-PA 1..137 1..137 771 100 Plus
CG17721-PC 149 CG17721-PC 1..149 1..137 748 91.9 Plus