Clone LP09315 Report

Search the DGRC for LP09315

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:93
Well:15
Vector:pOT2
Associated Gene/TranscriptSod3-RA
Protein status:LP09315.pep: gold
Sequenced Size:1070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9027 2002-11-16 Blastp of sequenced clone
CG9027 2008-04-29 Release 5.5 accounting
CG9027 2008-08-15 Release 5.9 accounting
CG9027 2008-12-18 5.12 accounting

Clone Sequence Records

LP09315.complete Sequence

1070 bp (1070 high quality bases) assembled on 2002-11-16

GenBank Submission: BT003225

> LP09315.complete
CAGGTTTCCAACGGTACAGAGGTGCAATCGCTTAATTCTCGCAAAAAACA
ATCAGTACCCAATTATAAAATAGTTGCTAACAAGATCGTTTCAGAACTCG
AGCGTGCAAGATCGCCAGCATATCGCAGACACATTGATAAGACCGTAAGG
AAACCGGACCCATAAACAAATATTGCCCCGATAAAGTGTGACACCCATCC
ATTTCATTTGTGGAACTTTGGAAGCGAATTCAAAATGATGCAATATCTTG
TTGTTAGCCTGGCACTCTGTGCCACAATTTGCTCTGCTGCGCAGACGCGC
AATATGCCCATTCAAGCCATTGCCTATCTGATTGGACCCGTGCAATCGGA
TAATACCCAGGTCAAGGGCAACGTGACCTTTACGCAGAACGACTGTGGCC
AGAATGTCCATGTGCGCGTCCAGCTGGAGGGATTGAAGGAGGGCAAGCAC
GGCTTCCACATTCACGAGAAGGGAGATCTGACCAATGGATGCATCAGCAT
GGGTGCTCACTATAACCCCGATAAGGTTGATCACGGTGGCCCCGATCACG
AGGTGCGTCATGTTGGCGATCTGGGCAACCTGGAGGCCAACTCCACGGGC
ATTATCGACGTTACATACACGGATCAGGTGATCACCTTAACTGGCAAGCT
GGGGATCATTGGCAGGGGAGTTGTTGTCCACGAATTGGAGGATGATCTCG
GTCTGGGCAACCACACGGATTCCAAGAAGACCGGCAATGCAGGCGGCCGC
ATTGCCTGTGGTGTTATTGGCATCAAGTAAATATCCCTTCCAACGTGTCA
GCCAAATCAATATGCTGCTCGAATACTTTATGTGTAGTTGTGTAACTCCA
GGCGTAGTAACTAATGAAATGTTTTCCCAATTTTCCCAATTCCCCCACCC
ACAATCACACTCACCCTTACATGTTTGGCTTACACATTTCCCTCAATTAA
TTGTCTCAGTTCACTGACTCACTCGATTTGCCGTGTGTGTGTTTGTGTGT
AATAAAATCAACAAAAATTAACCGAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

LP09315.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9027-RB 1133 CG9027-RB 102..1128 1..1027 5135 100 Plus
CG9027-RC 2635 CG9027-RC 1792..2590 229..1027 3995 100 Plus
CG9027.a 1641 CG9027.a 843..1641 229..1027 3995 100 Plus
CG9027-RC 2635 CG9027-RC 1031..1177 82..228 735 100 Plus
CG9027.a 1641 CG9027.a 93..228 93..228 680 100 Plus
CG9027.a 1641 CG9027.a 11..95 1..85 425 100 Plus
CG9027-RC 2635 CG9027-RC 11..94 1..84 420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7268774..7269044 1024..754 1340 99.6 Minus
chr2R 21145070 chr2R 7269391..7269625 531..297 1160 99.6 Minus
chr2R 21145070 chr2R 7269112..7269342 754..524 1110 98.7 Minus
chr2R 21145070 chr2R 7270374..7270520 228..82 705 98.6 Minus
chr2R 21145070 chr2R 7271457..7271540 84..1 420 100 Minus
chr2R 21145070 chr2R 7269691..7269759 297..229 330 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11381322..11381595 1027..754 1370 100 Minus
2R 25286936 2R 11381949..11382183 531..297 1160 99.6 Minus
2R 25286936 2R 11381663..11381893 754..524 1155 100 Minus
2R 25286936 2R 11382932..11383078 228..82 735 100 Minus
2R 25286936 2R 11384015..11384098 84..1 420 100 Minus
2R 25286936 2R 11382249..11382317 297..229 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11382521..11382794 1027..754 1370 100 Minus
2R 25260384 2R 11383148..11383382 531..297 1160 99.5 Minus
2R 25260384 2R 11382862..11383092 754..524 1155 100 Minus
2R 25260384 2R 11384131..11384277 228..82 735 100 Minus
2R 25260384 2R 11385214..11385297 84..1 420 100 Minus
2R 25260384 2R 11383448..11383516 297..229 345 100 Minus
Blast to na_te.dros performed 2019-03-15 19:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2245..2353 891..787 119 62.7 Minus

LP09315.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:17 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7270374..7270517 85..228 98 <- Minus
chr2R 7271457..7271540 1..84 100   Minus
chr2R 7268774..7269043 755..1024 99 <- Minus
chr2R 7269112..7269340 526..754 98 <- Minus
chr2R 7269397..7269624 298..525 100 <- Minus
chr2R 7269691..7269759 229..297 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:45 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RC 12..567 224..780 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:53 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RC 12..567 224..780 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:49:54 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RB 1..546 235..780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:48 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RC 12..567 224..780 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:49 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RB 1..546 235..780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:26 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RB 11..1034 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:53 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RB 11..1034 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:49:54 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RB 17..1040 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:48 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
CG9027-RB 11..1034 1..1024 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:49 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
Sod3-RB 17..1040 1..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:17 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381325..11381594 755..1024 100 <- Minus
2R 11381663..11381891 526..754 100 <- Minus
2R 11381955..11382182 298..525 100 <- Minus
2R 11382249..11382317 229..297 100 <- Minus
2R 11382932..11383075 85..228 100 <- Minus
2R 11384015..11384098 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:17 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381325..11381594 755..1024 100 <- Minus
2R 11381663..11381891 526..754 100 <- Minus
2R 11381955..11382182 298..525 100 <- Minus
2R 11382249..11382317 229..297 100 <- Minus
2R 11382932..11383075 85..228 100 <- Minus
2R 11384015..11384098 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:17 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11381325..11381594 755..1024 100 <- Minus
2R 11381663..11381891 526..754 100 <- Minus
2R 11381955..11382182 298..525 100 <- Minus
2R 11382249..11382317 229..297 100 <- Minus
2R 11382932..11383075 85..228 100 <- Minus
2R 11384015..11384098 1..84 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:49:54 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7271520..7271603 1..84 100   Minus
arm_2R 7268830..7269099 755..1024 100 <- Minus
arm_2R 7269168..7269396 526..754 100 <- Minus
arm_2R 7269460..7269687 298..525 100 <- Minus
arm_2R 7269754..7269822 229..297 100 <- Minus
arm_2R 7270437..7270580 85..228 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:40 Download gff for LP09315.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11384131..11384274 85..228 100 <- Minus
2R 11385214..11385297 1..84 100   Minus
2R 11382524..11382793 755..1024 100 <- Minus
2R 11382862..11383090 526..754 100 <- Minus
2R 11383154..11383381 298..525 100 <- Minus
2R 11383448..11383516 229..297 100 <- Minus

LP09315.hyp Sequence

Translation from 234 to 779

> LP09315.hyp
MMQYLVVSLALCATICSAAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFT
QNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDH
GGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHE
LEDDLGLGNHTDSKKTGNAGGRIACGVIGIK*

LP09315.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Sod3-PA 181 CG9027-PA 1..181 1..181 960 100 Plus
Sod3-PB 181 CG9027-PB 1..181 1..181 960 100 Plus
Sod3-PD 217 CG9027-PD 1..180 1..180 955 100 Plus
Sod3-PE 243 CG9027-PE 1..180 1..180 955 100 Plus
Sod-PA 153 CG11793-PA 10..150 40..180 374 55.3 Plus

LP09315.pep Sequence

Translation from 234 to 779

> LP09315.pep
MMQYLVVSLALCATICSAAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFT
QNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDH
GGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHE
LEDDLGLGNHTDSKKTGNAGGRIACGVIGIK*

LP09315.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12396-PA 210 GF12396-PA 1..173 2..180 759 82.1 Plus
Dana\GF24570-PA 153 GF24570-PA 1..150 24..180 348 51 Plus
Dana\GF18703-PA 124 GF18703-PA 9..121 68..180 287 54.9 Plus
Dana\GF11145-PA 263 GF11145-PA 86..225 39..178 268 44.1 Plus
Dana\GF16781-PA 267 GF16781-PA 94..245 27..180 153 27.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22650-PA 181 GG22650-PA 1..181 1..181 904 95 Plus
Dere\Sod-PA 153 GG13936-PA 10..150 40..180 349 54.6 Plus
Dere\GG25230-PA 264 GG25230-PA 86..226 39..178 248 43.8 Plus
Dere\GG11434-PA 270 GG11434-PA 94..245 27..180 161 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20507-PA 181 GH20507-PA 1..181 1..181 782 79 Plus
Dgri\GH11755-PA 181 GH11755-PA 1..181 1..181 759 77.3 Plus
Dgri\GH14640-PA 153 GH14640-PA 10..150 40..180 354 54.6 Plus
Dgri\GH19972-PA 285 GH19972-PA 108..248 39..179 274 46.5 Plus
Dgri\GH22309-PA 256 GH22309-PA 90..240 27..180 175 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sod3-PF 181 CG9027-PF 1..181 1..181 960 100 Plus
Sod3-PA 181 CG9027-PA 1..181 1..181 960 100 Plus
Sod3-PB 181 CG9027-PB 1..181 1..181 960 100 Plus
Sod3-PD 217 CG9027-PD 1..180 1..180 955 100 Plus
Sod3-PE 243 CG9027-PE 1..180 1..180 955 100 Plus
Sod1-PA 153 CG11793-PA 10..150 40..180 374 55.3 Plus
Sod1-PD 167 CG11793-PD 30..164 46..180 361 55.6 Plus
Ccs-PC 258 CG17753-PC 80..220 39..178 275 43.8 Plus
Ccs-PB 264 CG17753-PB 86..226 39..178 275 43.8 Plus
CG5948-PB 269 CG5948-PB 93..244 27..180 170 29 Plus
CG5948-PA 270 CG5948-PA 94..245 27..180 170 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21051-PA 181 GI21051-PA 1..181 1..181 784 79 Plus
Dmoj\GI11624-PA 153 GI11624-PA 10..150 40..180 347 54.6 Plus
Dmoj\GI20259-PA 236 GI20259-PA 86..219 39..172 250 44.5 Plus
Dmoj\GI22979-PA 271 GI22979-PA 105..247 37..180 166 27.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10397-PA 277 GL10397-PA 1..180 1..180 819 82.8 Plus
Dper\Sod-PA 152 GL22843-PA 9..149 40..180 350 53.9 Plus
Dper\GL20081-PA 263 GL20081-PA 86..225 39..178 259 42 Plus
Dper\GL21798-PA 267 GL21798-PA 95..246 27..180 163 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30465-PA 258 GA30465-PA 1..181 1..181 830 82.9 Plus
Dpse\GA30465-PB 181 GA30465-PB 1..181 1..181 824 82.9 Plus
Dpse\Sod-PA 152 GA11202-PA 9..149 40..180 350 53.9 Plus
Dpse\GA14646-PA 263 GA14646-PA 86..225 39..178 259 42 Plus
Dpse\GA19252-PA 266 GA19252-PA 94..245 27..180 163 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20432-PA 181 GM20432-PA 1..181 1..181 930 97.2 Plus
Dsec\Sod-PA 153 GM24771-PA 10..150 40..180 353 55.3 Plus
Dsec\GM20549-PA 264 GM20549-PA 86..226 39..178 248 43.8 Plus
Dsec\GM10274-PA 270 GM10274-PA 94..245 27..180 159 30.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25903-PA 181 GD25903-PA 1..181 1..181 936 98.3 Plus
Dsim\Sod-PA 153 GD12822-PA 10..150 40..180 353 55.3 Plus
Dsim\GD26004-PA 264 GD26004-PA 86..226 39..178 250 44.4 Plus
Dsim\GD21244-PA 270 GD21244-PA 94..245 27..180 163 30.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21975-PA 181 GJ21975-PA 1..181 1..181 761 76.8 Plus
Dvir\Sod-PA 153 GJ11304-PA 10..150 40..180 353 55.3 Plus
Dvir\GJ20212-PA 263 GJ20212-PA 86..225 39..178 266 44.8 Plus
Dvir\GJ24673-PA 268 GJ24673-PA 94..244 27..180 169 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21886-PA 181 GK21886-PA 1..181 1..181 790 80.7 Plus
Dwil\GK13564-PA 157 GK13564-PA 1..154 1..157 614 74.5 Plus
Dwil\Sod-PA 153 GK20556-PA 10..150 40..180 374 56.7 Plus
Dwil\GK23033-PA 252 GK23033-PA 87..215 39..179 175 35.2 Plus
Dwil\GK12866-PA 257 GK12866-PA 98..235 41..178 156 28.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13524-PA 181 GE13524-PA 1..181 1..181 914 95.6 Plus
Dyak\Sod-PA 153 GE20235-PA 10..150 40..180 344 53.9 Plus
Dyak\GE21764-PA 264 GE21764-PA 86..226 39..178 258 44.4 Plus
Dyak\GE23628-PA 270 GE23628-PA 108..245 43..180 158 30.1 Plus