Clone LP09525 Report

Search the DGRC for LP09525

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:95
Well:25
Vector:pOT2
Associated Gene/TranscriptCG15219-RC
Protein status:LP09525.pep: gold
Preliminary Size:503
Sequenced Size:498

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15219 2002-01-01 Sim4 clustering to Release 2
CG15219 2002-05-18 Blastp of sequenced clone
CG15219 2003-01-01 Sim4 clustering to Release 3
CG15219 2008-04-29 Release 5.5 accounting
CG15219 2008-08-15 Release 5.9 accounting
CG15219 2008-12-18 5.12 accounting

Clone Sequence Records

LP09525.complete Sequence

498 bp (498 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119075

> LP09525.complete
ATCTCTAAAAAACAAAAAAAAAAAAAATTGTAAAAATTTTATAAGAAAGT
CAAGTAAAATCTTTTTTCAAAATTTTCAGTCATGGAATACGGAAATGGTA
TGCAATACGATGGTTATAGCCAAGGTGGCGAGGGCTTTGAAATGCTGTAC
AACCAAACGAGCAGTGGCCATGGATATAGCCAGCAGCAGAGTAATTGCGG
ACAAGGTTCTTCAAATTTTAATGGTGCATCTGCATCGCTTGGTGGTCCTG
GCTATCGCAGTCCCTTGCGATACACAAAAATGCTTCGTGAGATGAACTCT
CGCAACGGGCTTTACAGCGGAGCAGTGGGCAAGGCGACTACTATAATACA
TTGCCCGGCCTTGGCGGCCCAGAAGGTCAAGCTTATCAGTCGCGGGGCAA
TGGAAATCCATACTACTAAAGTAAACCCATGCACTTCGTAGAAATTGTTG
ATATAATTTAATAAAATAAATTTTGAAAAAAAAAAAAAAAAAAAAAAA

LP09525.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219.b 481 CG15219.b 7..481 1..475 2375 100 Plus
CG15219.a 478 CG15219.a 7..478 1..475 2305 99.3 Plus
CG15219-RA 574 CG15219-RA 73..387 1..315 1575 100 Plus
CG15219-RA 574 CG15219-RA 403..566 315..478 820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22103643..22103826 314..131 920 100 Minus
chr2L 23010047 chr2L 22103418..22103578 475..315 790 99.4 Minus
chr2L 23010047 chr2L 22103877..22104000 133..10 590 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22105116..22105299 314..131 920 100 Minus
2L 23513712 2L 22104888..22105051 478..315 820 100 Minus
2L 23513712 2L 22105350..22105482 133..1 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22105116..22105299 314..131 920 100 Minus
2L 23513712 2L 22104888..22105051 478..315 820 100 Minus
2L 23513712 2L 22105350..22105482 133..1 665 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:25:23 has no hits.

LP09525.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:26:28 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22103443..22103578 315..450 99 <- Minus
chr2L 22103643..22103824 133..314 100 <- Minus
chr2L 22103878..22103965 45..132 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:52 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..233 82..314 100 <- Plus
CG15219-RA 248..354 315..419 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:16 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..233 82..314 100 <- Plus
CG15219-RA 248..354 315..419 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:32:58 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RC 1..360 82..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:39 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..233 82..314 100 <- Plus
CG15219-RA 248..354 315..419 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:35 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RC 1..360 82..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:02 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 25..338 1..314 100 <- Plus
CG15219-RA 353..515 315..475 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:16 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 25..338 1..314 100 <- Plus
CG15219-RA 353..515 315..475 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:32:58 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RC 31..505 1..475 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:39 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 25..338 1..314 100 <- Plus
CG15219-RA 353..515 315..475 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:35 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RC 31..505 1..475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:28 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105051 315..475 100 <- Minus
2L 22105116..22105297 133..314 100 <- Minus
2L 22105351..22105482 1..132 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:28 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105051 315..475 100 <- Minus
2L 22105116..22105297 133..314 100 <- Minus
2L 22105351..22105482 1..132 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:28 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105051 315..475 100 <- Minus
2L 22105116..22105297 133..314 100 <- Minus
2L 22105351..22105482 1..132 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:32:58 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22104891..22105051 315..475 100 <- Minus
arm_2L 22105116..22105297 133..314 100 <- Minus
arm_2L 22105351..22105482 1..132 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:29 Download gff for LP09525.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105051 315..475 100 <- Minus
2L 22105351..22105482 1..132 100   Minus
2L 22105116..22105297 133..314 100 <- Minus

LP09525.pep Sequence

Translation from 81 to 440

> LP09525.pep
MEYGNGMQYDGYSQGGEGFEMLYNQTSSGHGYSQQQSNCGQGSSNFNGAS
ASLGGPGYRSPLRYTKMLREMNSRNGLYSGAVGKATTIIHCPALAAQKVK
LISRGAMEIHTTKVNPCTS*

LP09525.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23721-PA 122 GF23721-PA 1..79 1..79 170 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21360-PA 120 GG21360-PA 1..114 1..114 479 81.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11280-PA 128 GH11280-PA 33..89 29..79 152 64.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219-PC 119 CG15219-PC 1..119 1..119 633 100 Plus
CG15219-PA 117 CG15219-PA 1..79 1..79 428 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24421-PA 126 GI24421-PA 34..87 23..79 152 61.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26111-PA 137 GL26111-PA 1..93 1..79 146 52.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13579-PA 137 GA13579-PA 1..93 1..79 146 52.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16117-PA 119 GM16117-PA 1..119 1..119 588 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21620-PA 119 GD21620-PA 1..119 1..119 590 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16205-PA 125 GJ16205-PA 50..86 43..79 148 81.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18700-PA 132 GK18700-PA 1..93 1..79 147 52.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12940-PA 113 GE12940-PA 1..113 1..113 468 82.3 Plus

LP09525.hyp Sequence

Translation from 81 to 440

> LP09525.hyp
MEYGNGMQYDGYSQGGEGFEMLYNQTSSGHGYSQQQSNCGQGSSNFNGAS
ASLGGPGYRSPLRYTKMLREMNSRNGLYSGAVGKATTIIHCPALAAQKVK
LISRGAMEIHTTKVNPCTS*

LP09525.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219-PC 119 CG15219-PC 1..119 1..119 633 100 Plus
CG15219-PA 117 CG15219-PA 1..79 1..79 428 100 Plus