BDGP Sequence Production Resources |
Search the DGRC for LP09593
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 95 |
Well: | 93 |
Vector: | pOT2 |
Associated Gene/Transcript | CG8664-RA |
Protein status: | LP09593.pep: gold |
Preliminary Size: | 697 |
Sequenced Size: | 710 |
Gene | Date | Evidence |
---|---|---|
CG8664 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8664 | 2002-05-18 | Blastp of sequenced clone |
CG8664 | 2003-01-01 | Sim4 clustering to Release 3 |
CG8664 | 2008-04-29 | Release 5.5 accounting |
CG8664 | 2008-08-15 | Release 5.9 accounting |
CG8664 | 2008-12-18 | 5.12 accounting |
710 bp (710 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119077
> LP09593.complete AAACCATCCACCAGTAACATGAAAGTACTCAACGTCTGCCTCTTGGTCGT GGCCTCTGCCAGCTTCCTTCTGGCCACAGCGAACGCCAGTGCCGTAGGTG CTTTCGAGGACTTCGAGCCCTACACCGATGCCGAGCTTAAGGATCTCTAC GCCGCCGAGTTGATGGCAATGGAGGATGAGTTCATGGGCGTCGAGCAGTT CGGCTTCATTGGATCGTGCCGCAAGATTCTGTGGGCCGGATACAAGGGCA TCAACGGCACCAAGTGCATCGTCGAGGAGGTGGCCAATGTGCTGCTCACC TGCACCAACTACGTAGACGACCTGAGCACCTGCACCGGCGATATTCCCAA GGATATCCAGGCCATGCTGAACAATGTCAAGCAAATGATCATCACCAGCA ACAAGATCATCAACATGAAGTCCGAGCTGTGCGCCTCCACCTCCAGGAGC GTCGTCTCCTCCACCAAGAGCTTCATGCGTTGCACCCTGAAGGCCTTCTA CGCCACCATGTCCCTTGTCCGCCGCATGAACACATTGATCAAGCAGGGCG CAGCCCTGCCCTTCAACACCTCTTCCTGCTACGTCGATGCCACCAAGAAG GTGGTCGACGGCTGCAACGCCTTTGTGCCCAACATCAATACCTGCATAGC CAGCATGACATAAGTTGGTAATAAAACCATGAAATTATGAGCAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6720..6900 | 298..475 | 122 | 54.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 17172073..17172156 | 1..84 | 98 | Minus | |
chrX | 17171226..17171833 | 85..692 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..645 | 19..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..645 | 19..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..645 | 19..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..645 | 19..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..645 | 19..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..692 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..692 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..692 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 1..692 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8664-RA | 16..707 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17281782..17282389 | 85..692 | 100 | <- | Minus |
X | 17282628..17282711 | 1..84 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17281782..17282389 | 85..692 | 100 | <- | Minus |
X | 17282628..17282711 | 1..84 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17281782..17282389 | 85..692 | 100 | <- | Minus |
X | 17282628..17282711 | 1..84 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 17175815..17176422 | 85..692 | 100 | <- | Minus |
arm_X | 17176661..17176744 | 1..84 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17289880..17290487 | 85..692 | 100 | <- | Minus |
X | 17290726..17290809 | 1..84 | 100 | Minus |
Translation from 0 to 662
> LP09593.hyp KPSTSNMKVLNVCLLVVASASFLLATANASAVGAFEDFEPYTDAELKDLY AAELMAMEDEFMGVEQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLT CTNYVDDLSTCTGDIPKDIQAMLNNVKQMIITSNKIINMKSELCASTSRS VVSSTKSFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCYVDATKK VVDGCNAFVPNINTCIASMT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8664-PB | 214 | CG8664-PB | 1..214 | 7..220 | 1092 | 100 | Plus |
CG8664-PA | 214 | CG8664-PA | 1..214 | 7..220 | 1092 | 100 | Plus |
CG5107-PA | 213 | CG5107-PA | 1..213 | 7..219 | 415 | 43 | Plus |
CG8661-PA | 198 | CG8661-PA | 29..193 | 51..215 | 172 | 27.4 | Plus |
Translation from 18 to 662
> LP09593.pep MKVLNVCLLVVASASFLLATANASAVGAFEDFEPYTDAELKDLYAAELMA MEDEFMGVEQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLTCTNYVD DLSTCTGDIPKDIQAMLNNVKQMIITSNKIINMKSELCASTSRSVVSSTK SFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCYVDATKKVVDGCN AFVPNINTCIASMT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22333-PA | 209 | GF22333-PA | 1..205 | 1..213 | 504 | 48.6 | Plus |
Dana\GF17271-PA | 212 | GF17271-PA | 1..212 | 1..213 | 369 | 39.7 | Plus |
Dana\GF17269-PA | 215 | GF17269-PA | 1..212 | 1..209 | 294 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18190-PA | 214 | GG18190-PA | 1..214 | 1..214 | 1021 | 89.7 | Plus |
Dere\GG11410-PA | 212 | GG11410-PA | 1..212 | 1..213 | 398 | 41.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12068-PA | 204 | GH12068-PA | 1..204 | 1..213 | 387 | 40.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8664-PB | 214 | CG8664-PB | 1..214 | 1..214 | 1092 | 100 | Plus |
CG8664-PA | 214 | CG8664-PA | 1..214 | 1..214 | 1092 | 100 | Plus |
CG5107-PA | 213 | CG5107-PA | 1..213 | 1..213 | 415 | 43 | Plus |
CG8661-PA | 198 | CG8661-PA | 29..193 | 45..209 | 172 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15559-PA | 206 | GI15559-PA | 1..204 | 1..209 | 272 | 30.6 | Plus |
Dmoj\GI13194-PA | 189 | GI13194-PA | 42..189 | 62..213 | 261 | 36.2 | Plus |
Dmoj\GI15040-PA | 209 | GI15040-PA | 10..203 | 14..209 | 150 | 25.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19884-PA | 208 | GL19884-PA | 1..208 | 1..213 | 448 | 46.5 | Plus |
Dper\GL19836-PA | 200 | GL19836-PA | 23..195 | 34..209 | 142 | 26.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28269-PA | 208 | GA28269-PA | 1..208 | 1..213 | 443 | 46.5 | Plus |
Dpse\GA21242-PA | 200 | GA21242-PA | 23..195 | 34..209 | 143 | 27.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13324-PA | 214 | GM13324-PA | 1..214 | 1..214 | 1052 | 93 | Plus |
Dsec\GM10249-PA | 210 | GM10249-PA | 1..210 | 1..213 | 395 | 41.2 | Plus |
Dsec\GM16341-PA | 62 | GM16341-PA | 1..62 | 153..214 | 290 | 90.3 | Plus |
Dsec\GM11374-PA | 83 | GM11374-PA | 1..42 | 153..194 | 195 | 88.1 | Plus |
Dsec\GM13323-PA | 198 | GM13323-PA | 29..193 | 45..209 | 143 | 26.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21222-PA | 212 | GD21222-PA | 1..212 | 1..213 | 413 | 42.1 | Plus |
Dsim\GD16053-PA | 62 | GD16053-PA | 1..62 | 153..214 | 300 | 91.9 | Plus |
Dsim\GD20330-PA | 62 | GD20330-PA | 1..62 | 153..214 | 298 | 91.9 | Plus |
Dsim\mkg-r-PA | 169 | GD24699-PA | 1..63 | 153..214 | 188 | 63.5 | Plus |
Dsim\GD15681-PA | 198 | GD15681-PA | 29..193 | 45..209 | 149 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15171-PA | 204 | GJ15171-PA | 1..204 | 1..213 | 374 | 39.9 | Plus |
Dvir\GJ11817-PA | 184 | GJ11817-PA | 1..184 | 1..213 | 303 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25811-PA | 212 | GK25811-PA | 1..212 | 1..213 | 409 | 44.3 | Plus |
Dwil\GK25812-PA | 214 | GK25812-PA | 1..214 | 1..213 | 406 | 43.9 | Plus |
Dwil\GK23759-PA | 201 | GK23759-PA | 1..201 | 1..213 | 405 | 46 | Plus |
Dwil\GK23760-PA | 206 | GK23760-PA | 1..202 | 1..210 | 337 | 37.6 | Plus |
Dwil\GK19214-PA | 216 | GK19214-PA | 1..216 | 1..213 | 252 | 29.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15604-PA | 219 | GE15604-PA | 1..219 | 1..214 | 957 | 83.1 | Plus |
Dyak\GE23606-PA | 212 | GE23606-PA | 1..212 | 1..213 | 414 | 43.1 | Plus |
Dyak\GE15603-PA | 198 | GE15603-PA | 29..193 | 45..209 | 145 | 26.8 | Plus |