Clone LP09593 Report

Search the DGRC for LP09593

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:95
Well:93
Vector:pOT2
Associated Gene/TranscriptCG8664-RA
Protein status:LP09593.pep: gold
Preliminary Size:697
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8664 2002-01-01 Sim4 clustering to Release 2
CG8664 2002-05-18 Blastp of sequenced clone
CG8664 2003-01-01 Sim4 clustering to Release 3
CG8664 2008-04-29 Release 5.5 accounting
CG8664 2008-08-15 Release 5.9 accounting
CG8664 2008-12-18 5.12 accounting

Clone Sequence Records

LP09593.complete Sequence

710 bp (710 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119077

> LP09593.complete
AAACCATCCACCAGTAACATGAAAGTACTCAACGTCTGCCTCTTGGTCGT
GGCCTCTGCCAGCTTCCTTCTGGCCACAGCGAACGCCAGTGCCGTAGGTG
CTTTCGAGGACTTCGAGCCCTACACCGATGCCGAGCTTAAGGATCTCTAC
GCCGCCGAGTTGATGGCAATGGAGGATGAGTTCATGGGCGTCGAGCAGTT
CGGCTTCATTGGATCGTGCCGCAAGATTCTGTGGGCCGGATACAAGGGCA
TCAACGGCACCAAGTGCATCGTCGAGGAGGTGGCCAATGTGCTGCTCACC
TGCACCAACTACGTAGACGACCTGAGCACCTGCACCGGCGATATTCCCAA
GGATATCCAGGCCATGCTGAACAATGTCAAGCAAATGATCATCACCAGCA
ACAAGATCATCAACATGAAGTCCGAGCTGTGCGCCTCCACCTCCAGGAGC
GTCGTCTCCTCCACCAAGAGCTTCATGCGTTGCACCCTGAAGGCCTTCTA
CGCCACCATGTCCCTTGTCCGCCGCATGAACACATTGATCAAGCAGGGCG
CAGCCCTGCCCTTCAACACCTCTTCCTGCTACGTCGATGCCACCAAGAAG
GTGGTCGACGGCTGCAACGCCTTTGTGCCCAACATCAATACCTGCATAGC
CAGCATGACATAAGTTGGTAATAAAACCATGAAATTATGAGCAAAAAAAA
AAAAAAAAAA

LP09593.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8664.a 1489 CG8664.a 24..718 1..695 3475 100 Plus
CG8664-RA 1069 CG8664-RA 136..830 1..695 3475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17171226..17171833 692..85 2965 99.2 Minus
chrX 22417052 chrX 17172072..17172156 85..1 410 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17281779..17282389 695..85 3055 100 Minus
X 23542271 X 17282627..17282711 85..1 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17289877..17290487 695..85 3055 100 Minus
X 23527363 X 17290725..17290809 85..1 425 100 Minus
Blast to na_te.dros performed 2019-03-16 20:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6900 298..475 122 54.9 Plus

LP09593.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:50:49 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17172073..17172156 1..84 98   Minus
chrX 17171226..17171833 85..692 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:39:58 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..645 19..663 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:29 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..645 19..663 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:01 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..645 19..663 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:29 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..645 19..663 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:55:43 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..645 19..663 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:18 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..692 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:29 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..692 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:01 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..692 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:29 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 1..692 1..692 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:55:43 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
CG8664-RA 16..707 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:49 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
X 17281782..17282389 85..692 100 <- Minus
X 17282628..17282711 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:49 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
X 17281782..17282389 85..692 100 <- Minus
X 17282628..17282711 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:49 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
X 17281782..17282389 85..692 100 <- Minus
X 17282628..17282711 1..84 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:01 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17175815..17176422 85..692 100 <- Minus
arm_X 17176661..17176744 1..84 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:22 Download gff for LP09593.complete
Subject Subject Range Query Range Percent Splice Strand
X 17289880..17290487 85..692 100 <- Minus
X 17290726..17290809 1..84 100   Minus

LP09593.hyp Sequence

Translation from 0 to 662

> LP09593.hyp
KPSTSNMKVLNVCLLVVASASFLLATANASAVGAFEDFEPYTDAELKDLY
AAELMAMEDEFMGVEQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLT
CTNYVDDLSTCTGDIPKDIQAMLNNVKQMIITSNKIINMKSELCASTSRS
VVSSTKSFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCYVDATKK
VVDGCNAFVPNINTCIASMT*

LP09593.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8664-PB 214 CG8664-PB 1..214 7..220 1092 100 Plus
CG8664-PA 214 CG8664-PA 1..214 7..220 1092 100 Plus
CG5107-PA 213 CG5107-PA 1..213 7..219 415 43 Plus
CG8661-PA 198 CG8661-PA 29..193 51..215 172 27.4 Plus

LP09593.pep Sequence

Translation from 18 to 662

> LP09593.pep
MKVLNVCLLVVASASFLLATANASAVGAFEDFEPYTDAELKDLYAAELMA
MEDEFMGVEQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLTCTNYVD
DLSTCTGDIPKDIQAMLNNVKQMIITSNKIINMKSELCASTSRSVVSSTK
SFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCYVDATKKVVDGCN
AFVPNINTCIASMT*

LP09593.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22333-PA 209 GF22333-PA 1..205 1..213 504 48.6 Plus
Dana\GF17271-PA 212 GF17271-PA 1..212 1..213 369 39.7 Plus
Dana\GF17269-PA 215 GF17269-PA 1..212 1..209 294 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18190-PA 214 GG18190-PA 1..214 1..214 1021 89.7 Plus
Dere\GG11410-PA 212 GG11410-PA 1..212 1..213 398 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12068-PA 204 GH12068-PA 1..204 1..213 387 40.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8664-PB 214 CG8664-PB 1..214 1..214 1092 100 Plus
CG8664-PA 214 CG8664-PA 1..214 1..214 1092 100 Plus
CG5107-PA 213 CG5107-PA 1..213 1..213 415 43 Plus
CG8661-PA 198 CG8661-PA 29..193 45..209 172 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15559-PA 206 GI15559-PA 1..204 1..209 272 30.6 Plus
Dmoj\GI13194-PA 189 GI13194-PA 42..189 62..213 261 36.2 Plus
Dmoj\GI15040-PA 209 GI15040-PA 10..203 14..209 150 25.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19884-PA 208 GL19884-PA 1..208 1..213 448 46.5 Plus
Dper\GL19836-PA 200 GL19836-PA 23..195 34..209 142 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28269-PA 208 GA28269-PA 1..208 1..213 443 46.5 Plus
Dpse\GA21242-PA 200 GA21242-PA 23..195 34..209 143 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13324-PA 214 GM13324-PA 1..214 1..214 1052 93 Plus
Dsec\GM10249-PA 210 GM10249-PA 1..210 1..213 395 41.2 Plus
Dsec\GM16341-PA 62 GM16341-PA 1..62 153..214 290 90.3 Plus
Dsec\GM11374-PA 83 GM11374-PA 1..42 153..194 195 88.1 Plus
Dsec\GM13323-PA 198 GM13323-PA 29..193 45..209 143 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21222-PA 212 GD21222-PA 1..212 1..213 413 42.1 Plus
Dsim\GD16053-PA 62 GD16053-PA 1..62 153..214 300 91.9 Plus
Dsim\GD20330-PA 62 GD20330-PA 1..62 153..214 298 91.9 Plus
Dsim\mkg-r-PA 169 GD24699-PA 1..63 153..214 188 63.5 Plus
Dsim\GD15681-PA 198 GD15681-PA 29..193 45..209 149 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15171-PA 204 GJ15171-PA 1..204 1..213 374 39.9 Plus
Dvir\GJ11817-PA 184 GJ11817-PA 1..184 1..213 303 35.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25811-PA 212 GK25811-PA 1..212 1..213 409 44.3 Plus
Dwil\GK25812-PA 214 GK25812-PA 1..214 1..213 406 43.9 Plus
Dwil\GK23759-PA 201 GK23759-PA 1..201 1..213 405 46 Plus
Dwil\GK23760-PA 206 GK23760-PA 1..202 1..210 337 37.6 Plus
Dwil\GK19214-PA 216 GK19214-PA 1..216 1..213 252 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15604-PA 219 GE15604-PA 1..219 1..214 957 83.1 Plus
Dyak\GE23606-PA 212 GE23606-PA 1..212 1..213 414 43.1 Plus
Dyak\GE15603-PA 198 GE15603-PA 29..193 45..209 145 26.8 Plus