Clone LP09647 Report

Search the DGRC for LP09647

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:96
Well:47
Vector:pOT2
Associated Gene/TranscriptLcp2-RA
Protein status:LP09647.pep: gold
Sequenced Size:547

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2009-02-17 I'm sure there was a reason

Clone Sequence Records

LP09647.complete Sequence

547 bp assembled on 2009-02-17

GenBank Submission: BT059794.1

> LP09647.complete
TTCGTTCTCGACCAGACAGAAATCAGCCAACATGTTCAAGTTTGTGATGA
TTCTCGCCGTTGTGGGAGTGGCTACCGCCCTAGCCCCAGTTTCCCGCTCC
GATGATGTACACGCTGATGTCCTTTCCCGATCGGACGACGTTCGTGCCGA
CGGATTCGACTCCAGCCTGCACACCTCAAACGGAATCGAGCAGGCCGCCA
GCGGTGATGCCCATGGCAACATCCACGGCAACTTCGGCTGGATCTCACCC
GAGGGCGAGCACGTTGAGGTAAAGTACGTCGCGAATGAAAACGGATACCA
GCCCTCGGGAGCCTGGATCCCCACTCCTCCTCCAATCCCAGAGGCCATCG
CCCGCGCCGTTGCCTGGCTGGAGTCTCACCCCCCAGCACCCGAGCACCCC
CGTCATCACTAGGACTCGTCACCCGGATCCCGGACCACTCCACGGACTGT
TCTCCCGAAACAAATCGCCCAAGTTGTTTAGCTGTACTTCTTGACTTTCA
AAAAAATACATGCACTTGCTTATAGCAGTAAAAAAAAAAAAAAAAAA

LP09647.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-RA 547 Lcp2-RA 12..545 1..534 2670 100 Plus
Lcp2.a 792 Lcp2.a 257..790 1..534 2670 100 Plus
Lcp1-RA 535 Lcp1-RA 106..424 94..412 1310 94 Plus
Lcp1-RA 535 Lcp1-RA 1..51 1..51 210 94.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4321500..4321985 529..44 2430 100 Minus
chr2R 21145070 chr2R 4318271..4318589 412..94 1325 94.4 Minus
chr2R 21145070 chr2R 4322044..4322090 47..1 235 100 Minus
chr2R 21145070 chr2R 4318714..4318758 45..1 195 95.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp1Psi-RA 456 CR30367-RA 223..324 239..339 170 79.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8433969..8434459 534..44 2455 100 Minus
2R 25286936 2R 8430745..8431063 412..94 1310 94 Minus
2R 25286936 2R 8434518..8434564 47..1 235 100 Minus
2R 25286936 2R 8431188..8431232 45..1 195 95.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8435168..8435658 534..44 2455 100 Minus
2R 25260384 2R 8431944..8432262 412..94 1310 94 Minus
2R 25260384 2R 8435717..8435763 47..1 235 100 Minus
2R 25260384 2R 8432387..8432431 45..1 195 95.5 Minus
2R 25260384 2R 8434217..8434318 339..239 170 79.4 Minus
Blast to na_te.dros performed on 2019-03-15 23:41:21 has no hits.

LP09647.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:42:29 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4321500..4321985 44..529 100 <- Minus
chr2R 4322048..4322090 1..43 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:39 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 1..381 32..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:48 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 1..381 32..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:50 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 1..381 32..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:51 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 1..381 32..412 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:47 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-17 14:21:14 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 12..540 1..529 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:48 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 12..540 1..529 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:50 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 12..540 1..529 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:51 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 12..540 1..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:29 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8433974..8434459 44..529 100 <- Minus
2R 8434522..8434564 1..43 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:29 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8433974..8434459 44..529 100 <- Minus
2R 8434522..8434564 1..43 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:29 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8433974..8434459 44..529 100 <- Minus
2R 8434522..8434564 1..43 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:50 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4321479..4321964 44..529 100 <- Minus
arm_2R 4322027..4322069 1..43 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:08 Download gff for LP09647.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8435173..8435658 44..529 100 <- Minus
2R 8435721..8435763 1..43 100   Minus

LP09647.hyp Sequence

Translation from 0 to 411

> LP09647.hyp
SFSTRQKSANMFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRAD
GFDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQ
PSGAWIPTPPPIPEAIARAVAWLESHPPAPEHPRHH*

LP09647.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-PB 126 CG8697-PB 1..126 11..136 679 100 Plus
Lcp2-PA 126 CG8697-PA 1..126 11..136 679 100 Plus
Lcp1-PB 130 CG11650-PB 1..130 11..136 624 90 Plus
Lcp1-PA 130 CG11650-PA 1..130 11..136 624 90 Plus
Lcp4-PB 112 CG2044-PB 1..109 11..127 298 48.7 Plus

LP09647.pep Sequence

Translation from 1 to 411

> LP09647.pep
SFSTRQKSANMFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRAD
GFDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQ
PSGAWIPTPPPIPEAIARAVAWLESHPPAPEHPRHH*

LP09647.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12589-PA 128 GF12589-PA 1..128 11..136 531 83.6 Plus
Dana\GF12590-PA 130 GF12590-PA 1..130 11..136 509 76.9 Plus
Dana\GF12356-PA 112 GF12356-PA 19..109 37..127 281 54.9 Plus
Dana\GF10274-PA 119 GF10274-PA 16..117 35..128 258 52.4 Plus
Dana\GF12355-PA 112 GF12355-PA 27..109 45..127 257 56.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10645-PA 130 GG10645-PA 1..130 11..136 580 86.2 Plus
Dere\GG10643-PA 126 GG10643-PA 1..126 11..136 533 90.5 Plus
Dere\GG23356-PA 112 GG23356-PA 1..109 11..127 304 48.7 Plus
Dere\GG23355-PA 112 GG23355-PA 21..109 39..127 262 56.2 Plus
Dere\GG13245-PA 121 GG13245-PA 1..116 11..130 243 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20893-PA 265 GH20893-PA 146..265 15..136 420 64.8 Plus
Dgri\GH20994-PA 124 GH20994-PA 1..121 11..131 412 63.6 Plus
Dgri\GH20812-PA 117 GH20812-PA 1..117 11..136 314 54.7 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..117 11..131 229 37.6 Plus
Dgri\GH15299-PA 118 GH15299-PA 1..115 11..127 226 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-PB 126 CG8697-PB 1..126 11..136 679 100 Plus
Lcp2-PA 126 CG8697-PA 1..126 11..136 679 100 Plus
Lcp1-PB 130 CG11650-PB 1..130 11..136 624 90 Plus
Lcp1-PA 130 CG11650-PA 1..130 11..136 624 90 Plus
Lcp4-PB 112 CG2044-PB 1..109 11..127 298 48.7 Plus
Lcp4-PA 112 CG2044-PA 1..109 11..127 298 48.7 Plus
Lcp3-PB 112 CG2043-PB 1..109 11..127 269 46.2 Plus
Lcp3-PA 112 CG2043-PA 1..109 11..127 269 46.2 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..117 11..127 246 39.8 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 11..127 245 39 Plus
Edg78E-PB 122 CG7673-PB 1..116 11..130 234 39.5 Plus
Edg78E-PA 122 CG7673-PA 1..116 11..130 234 39.5 Plus
Cpr78Cc-PA 119 CG7658-PA 1..119 11..130 220 40.8 Plus
Cpr67Fb-PA 122 CG18348-PA 1..114 11..127 208 35.6 Plus
Cpr65Ea-PA 127 CG8640-PA 1..116 11..131 199 36.4 Plus
Cpr65Eb-PA 179 CG8638-PA 7..130 15..136 194 33.1 Plus
Cpr47Eg-PA 117 CG9070-PA 5..116 21..129 190 36.8 Plus
Cpr65Ec-PA 127 CG8634-PA 5..116 14..127 185 33.9 Plus
Cpr49Aa-PB 144 CG30045-PB 33..133 40..131 185 39.6 Plus
Cpr47Ef-PD 601 CG13214-PD 136..226 40..121 168 40.7 Plus
Cpr47Ef-PC 612 CG13214-PC 136..226 40..121 168 40.7 Plus
Cpr49Ae-PA 134 CG8505-PA 1..131 11..129 162 32.1 Plus
Pcp-PA 184 CG3440-PA 4..117 11..127 154 33.9 Plus
Cpr49Af-PB 126 CG8510-PB 2..118 13..127 150 27.4 Plus
Cpr49Af-PA 126 CG8510-PA 2..118 13..127 150 27.4 Plus
Cpr65Az-PA 239 CG12330-PA 151..206 61..120 142 45 Plus
Cpr47Ea-PA 135 CG9079-PA 32..129 29..117 141 33.7 Plus
Cpr78Cb-PB 140 CG7663-PB 55..128 52..126 141 37.3 Plus
Cpr78Cb-PA 140 CG7663-PA 55..128 52..126 141 37.3 Plus
Cpr100A-PA 241 CG12045-PA 1..102 11..113 140 29.8 Plus
Cpr65Ax2-PB 102 CG18777-PB 2..100 13..110 136 29.2 Plus
Cpr65Ax2-PA 102 CG18777-PA 2..100 13..110 136 29.2 Plus
Cpr65Ax1-PA 102 CG34270-PA 2..100 13..110 136 29.2 Plus
Cpr78Ca-PA 127 CG11310-PA 46..121 52..131 135 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20903-PA 122 GI20903-PA 1..122 11..132 419 63.9 Plus
Dmoj\GI20904-PA 119 GI20904-PA 1..119 11..132 408 63.1 Plus
Dmoj\GI20905-PA 121 GI20905-PA 1..119 11..132 399 63.1 Plus
Dmoj\GI18692-PA 144 GI18692-PA 32..134 29..131 375 68 Plus
Dmoj\GI20899-PA 150 GI20899-PA 1..145 11..136 372 54.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10863-PA 126 GL10863-PA 1..126 11..136 454 73 Plus
Dper\GL10864-PA 137 GL10864-PA 1..137 11..136 364 57.7 Plus
Dper\GL24679-PA 120 GL24679-PA 1..120 11..131 264 48 Plus
Dper\GL22414-PA 112 GL22414-PA 19..109 37..127 253 51.6 Plus
Dper\GL20440-PA 112 GL20440-PA 19..109 37..127 253 51.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24514-PA 138 GA24514-PA 1..135 11..136 464 69.1 Plus
Dpse\GA21266-PA 126 GA21266-PA 1..126 11..136 453 72.2 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..120 11..131 261 47.2 Plus
Dpse\GA15201-PA 112 GA15201-PA 19..109 37..127 253 51.6 Plus
Dpse\GA24647-PA 112 GA24647-PA 19..109 37..127 253 51.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20688-PA 126 GM20688-PA 1..126 11..136 624 92.9 Plus
Dsec\GM20690-PA 130 GM20690-PA 1..130 11..136 571 85.4 Plus
Dsec\GM21031-PA 112 GM21031-PA 1..109 11..127 299 48.7 Plus
Dsec\GM20689-PA 123 GM20689-PA 1..117 11..135 268 50 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..116 11..130 243 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10171-PA 130 GD10171-PA 1..130 11..136 576 86.2 Plus
Dsim\GD10560-PA 112 GD10560-PA 21..109 39..127 281 58.4 Plus
Dsim\GD22274-PA 112 GD22274-PA 21..109 39..127 281 58.4 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..116 11..130 243 39.5 Plus
Dsim\GD14949-PA 120 GD14949-PA 19..120 33..131 217 43.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20634-PA 126 GJ20634-PA 1..126 11..136 435 62.7 Plus
Dvir\GJ21708-PA 131 GJ21708-PA 23..131 28..136 398 67 Plus
Dvir\GJ20635-PA 117 GJ20635-PA 1..117 16..132 389 60.7 Plus
Dvir\GJ20631-PA 166 GJ20631-PA 1..149 11..131 385 54.6 Plus
Dvir\GJ20637-PA 117 GJ20637-PA 1..112 11..127 363 57.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21815-PA 129 GK21815-PA 1..129 11..136 450 68.2 Plus
Dwil\GK21499-PA 114 GK21499-PA 19..114 37..132 281 54.2 Plus
Dwil\GK20466-PA 121 GK20466-PA 2..117 11..127 247 44.6 Plus
Dwil\GK20425-PA 121 GK20425-PA 1..116 11..130 224 36.3 Plus
Dwil\GK17540-PA 191 GK17540-PA 1..122 11..127 220 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23024-PA 126 GE23024-PA 1..126 11..136 629 93.7 Plus
Dyak\GE23045-PA 130 GE23045-PA 1..130 11..136 558 82.3 Plus
Dyak\GE19198-PA 112 GE19198-PA 1..109 11..127 299 49.6 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..116 11..130 236 38.7 Plus
Dyak\GE21770-PA 122 GE21770-PA 1..114 11..127 217 37.3 Plus