Clone LP09837 Report

Search the DGRC for LP09837

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:98
Well:37
Vector:pOT2
Associated Gene/TranscriptCG10853-RA
Protein status:LP09837.pep: gold
Preliminary Size:793
Sequenced Size:615

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10853 2001-01-01 Release 2 assignment
CG10853 2002-01-09 Blastp of sequenced clone
CG10853 2003-01-01 Sim4 clustering to Release 3
CG10853 2008-04-29 Release 5.5 accounting
CG10853 2008-08-15 Release 5.9 accounting
CG10853 2008-12-18 5.12 accounting

Clone Sequence Records

LP09837.complete Sequence

615 bp (615 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075437

> LP09837.complete
CTTTCAAGTGACTGGAGCTGAGATGAGGAAATTAGTTATATCCCTAGCTG
TGCTAGGACTAATATCCCTGGCCTTGGGTCACAATAATCCCTGGGAGCAG
CAGCCCACTCCGATAAAGAAGGTGCCAGTGCCTGTTCCGGTGCCAGTTCC
TGTGCCAGTTCCTGTTCCTGTTTATCCCAAAGAAGGAGGTGGCGGAGGAG
GTGGTAGTGGCGGTGGTGGTGGTGGAGGTGGTGGCGCCGGCGGAGGAAGC
GGAAGTGGAGAAGGTGGCGGCGGAGCAATCGGCGGCACTTGCCCGCGTCC
TTCTCCCGAAGCTTTACGGTGCCTGCGGGAATGGGCCTGTCAGTACGTCA
TCCGGCTGGATCTGCGCTGCCTGCTCACTTTAAATGGCAACCCATTGCTG
GGCAATCTCATTTCCATACCCGGCATCACCGGAGGCGGCAGCAGCAGCGG
CGGCGGTGGCATCTTGGGTGGACTCCTGGGTGGCAAATAGAGGACCCCGT
TCGGTGGCGAAAATGTGCTCACATTAAACCCAATAAAGTTGCCACAGCAC
TGGCAAAAATAAAATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

LP09837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10853-RA 613 CG10853-RA 22..589 1..568 2840 100 Plus
CG10853.a 409 CG10853.a 22..387 1..366 1830 100 Plus
CG32073-RA 366 CG32073-RA 164..212 168..120 200 93.8 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3947461..3947694 86..319 1170 100 Plus
chr3L 24539361 chr3L 3947893..3948094 366..567 995 99.5 Plus
chr3L 24539361 chr3L 3947319..3947403 1..85 410 98.8 Plus
chr3L 24539361 chr3L 3947766..3947813 319..366 240 100 Plus
chr3L 24539361 chr3L 11098036..11098084 120..168 200 93.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:53:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3948054..3948287 86..319 1170 100 Plus
3L 28110227 3L 3948486..3948688 366..568 1015 100 Plus
3L 28110227 3L 3947912..3947996 1..85 425 100 Plus
3L 28110227 3L 3948359..3948406 319..366 240 100 Plus
3L 28110227 3L 11107165..11107213 120..168 200 93.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3948054..3948287 86..319 1170 100 Plus
3L 28103327 3L 3948486..3948688 366..568 1015 100 Plus
3L 28103327 3L 3947912..3947996 1..85 425 100 Plus
3L 28103327 3L 3948359..3948406 319..366 240 100 Plus
3L 28103327 3L 11100265..11100313 120..168 200 93.8 Plus
Blast to na_te.dros performed 2019-03-16 11:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 8630..8685 426..484 116 71.2 Plus

LP09837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:39:26 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3947319..3947403 1..85 98 -> Plus
chr3L 3947461..3947694 86..319 64 -> Plus
chr3L 3947767..3947813 320..366 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:09 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..468 23..490 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:52 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..468 23..490 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:09:02 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..468 23..490 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:23 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..468 23..490 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:23:18 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..468 23..490 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:33:51 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:52 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:09:02 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 22..588 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:23 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:23:18 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
CG10853-RA 22..588 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:26 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948360..3948406 320..366 100 -> Plus
3L 3947912..3947996 1..85 100 -> Plus
3L 3948054..3948287 86..319 100 -> Plus
3L 3948487..3948687 367..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:26 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948360..3948406 320..366 100 -> Plus
3L 3947912..3947996 1..85 100 -> Plus
3L 3948054..3948287 86..319 100 -> Plus
3L 3948487..3948687 367..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:26 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948360..3948406 320..366 100 -> Plus
3L 3947912..3947996 1..85 100 -> Plus
3L 3948054..3948287 86..319 100 -> Plus
3L 3948487..3948687 367..567 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:09:02 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3948487..3948687 367..567 100   Plus
arm_3L 3947912..3947996 1..85 100 -> Plus
arm_3L 3948054..3948287 86..319 100 -> Plus
arm_3L 3948360..3948406 320..366 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:59 Download gff for LP09837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948487..3948687 367..567 100   Plus
3L 3948054..3948287 86..319 100 -> Plus
3L 3948360..3948406 320..366 100 -> Plus
3L 3947912..3947996 1..85 100 -> Plus

LP09837.hyp Sequence

Translation from 0 to 489

> LP09837.hyp
FQVTGAEMRKLVISLAVLGLISLALGHNNPWEQQPTPIKKVPVPVPVPVP
VPVPVPVYPKEGGGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGGTCPRP
SPEALRCLREWACQYVIRLDLRCLLTLNGNPLLGNLISIPGITGGGSSSG
GGGILGGLLGGK*

LP09837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG10853-PA 155 CG10853-PA 1..155 8..162 837 100 Plus
TwdlT-PA 286 CG5812-PA 84..117 62..95 151 79.4 Plus
Ubx-PB 346 CG10388-PB 107..202 62..161 150 41.2 Plus
CG1840-PB 117 CG1840-PB 64..93 62..91 144 83.3 Plus
CG1840-PA 118 CG1840-PA 65..94 62..91 144 83.3 Plus

LP09837.pep Sequence

Translation from 22 to 489

> LP09837.pep
MRKLVISLAVLGLISLALGHNNPWEQQPTPIKKVPVPVPVPVPVPVPVPV
YPKEGGGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGGTCPRPSPEALRC
LREWACQYVIRLDLRCLLTLNGNPLLGNLISIPGITGGGSSSGGGGILGG
LLGGK*

LP09837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25019-PA 164 GF25019-PA 99..143 89..133 242 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15173-PA 152 GG15173-PA 1..133 1..136 363 87.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15770-PA 104 GH15770-PA 21..87 67..133 135 56.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10853-PA 155 CG10853-PA 1..155 1..155 837 100 Plus
TwdlT-PA 286 CG5812-PA 84..117 55..88 151 79.4 Plus
Ubx-PB 346 CG10388-PB 107..202 55..154 150 41.2 Plus
Ubx-PF 355 CG10388-PF 107..202 55..154 150 41.2 Plus
Ubx-PD 363 CG10388-PD 107..202 55..154 150 41.2 Plus
Ubx-PC 372 CG10388-PC 107..202 55..154 150 41.2 Plus
Ubx-PE 380 CG10388-PE 107..202 55..154 150 41.2 Plus
Ubx-PA 389 CG10388-PA 107..202 55..154 150 41.2 Plus
CG1840-PB 117 CG1840-PB 64..93 55..84 144 83.3 Plus
CG1840-PA 118 CG1840-PA 65..94 55..84 144 83.3 Plus
caz-PD 355 CG3606-PD 185..280 53..154 144 39.1 Plus
caz-PC 384 CG3606-PC 214..309 53..154 144 39.1 Plus
caz-PB 399 CG3606-PB 229..324 53..154 144 39.1 Plus
Rbp1-like-PC 158 CG1987-PC 91..123 55..87 143 75.8 Plus
Rbp1-like-PA 158 CG1987-PA 91..123 55..87 143 75.8 Plus
Rbp1-like-PB 247 CG1987-PB 91..123 55..87 143 75.8 Plus
CG14742-PA 74 CG14742-PA 5..39 53..87 140 71.4 Plus
CG2150-PA 188 CG2150-PA 26..112 51..150 139 38.3 Plus
CG14324-PA 131 CG14324-PA 53..130 27..92 137 45.6 Plus
CG14742-PA 74 CG14742-PA 17..54 55..88 135 68.4 Plus
CG5172-PC 106 CG5172-PC 25..58 55..88 135 73.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12549-PA 161 GI12549-PA 86..134 85..133 193 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28472-PA 156 GA28472-PA 1..135 1..133 240 77 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14602-PA 164 GM14602-PA 1..142 1..133 357 85.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13793-PA 163 GD13793-PA 1..141 1..133 358 85.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17506-PA 137 GK17506-PA 73..101 88..116 159 89.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21391-PA 172 GE21391-PA 1..150 1..133 354 78.7 Plus