Clone LP09874 Report

Search the DGRC for LP09874

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:98
Well:74
Vector:pOT2
Associated Gene/TranscriptCG4741-RA
Protein status:LP09874.pep: gold
Preliminary Size:705
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4741 2002-01-01 Sim4 clustering to Release 2
CG4741 2002-05-18 Blastp of sequenced clone
CG4741 2003-01-01 Sim4 clustering to Release 3
CG4741 2008-04-29 Release 5.5 accounting
CG4741 2008-08-15 Release 5.9 accounting
CG4741 2008-12-18 5.12 accounting

Clone Sequence Records

LP09874.complete Sequence

849 bp (849 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119080

> LP09874.complete
TCGGCTCTGTCTGTTCGTCAGAGAACTGCTGTCTTCGAGACATTTTTCAG
TTCCAATCAGGAATTAACACCCGAGTTCAACATGGCCCCTGCCATAAACG
CGACGGTCAGCACCCCTTTTGACTCCACCACGGTGGCCAACGGAACACTT
AACACCACTGAAAGTACGACATCGGATTGGGAATACGTTAACACCACTTC
CGTCACAATTTGGATCAACGGTGGCGGCTACGATGGTCCATACATGTTAT
TTTATCCCAGCTATGTCATTTACATTGTGCTGGTCTTCCTCTTCGTCATC
GCCTTTCCTCTGGCCATGATTATGAGCGCCAAACGCAAGCGAGAGACCAA
TGTGCGGAATCTGGCCCAGCAGAGACAACGAGCCCGTCGCCAAATGGAGA
TCAATGTGACGAACAATTGCAACGGCGGCTCCGGAGGAGTCGGAAACGTG
TGCTCAAACAGCCAGAACGAAGTTAGTGTCCTGCCCAAGACCTTGGATTT
GCCGCCCAGCTACGACGAGGCCGCTTTTAGCGAGCGAAAGCAGGACAGCA
CACTGACCATAGCCACCAGCTTGGAAGCGAGCAATCCCAATTTGGCGGTT
GGAATTAACGAACCACCGCCGGTTTACGAGGCGAACGTGGCCACAACCAC
CACTTCCACCACCACCACCGTATTTTTGGTCAACGGCCAACCACCAGTGG
TGTAACAAAGCATTGGACTTCTGAGAAATAGTAAATCTATTATTATTTAT
ACACTAAACAAGACACTGTACAGCTTTGCCTTTGTAAATAAATCTTGCTC
CTCGGCAACTCTTTAATTTTGCATAACTTATAAAAAAAAAAAAAAAAAA

LP09874.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4741-RA 946 CG4741-RA 76..909 1..834 4170 100 Plus
nc_9286.a 880 nc_9286.a 437..880 381..824 2220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20496711..20497161 831..381 2225 99.6 Minus
chr2R 21145070 chr2R 20499913..20500236 324..1 1620 100 Minus
chr2R 21145070 chr2R 20499794..20499852 382..324 295 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24610831..24611284 834..381 2270 100 Minus
2R 25286936 2R 24614033..24614356 324..1 1620 100 Minus
2R 25286936 2R 24613914..24613972 382..324 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24612030..24612483 834..381 2270 100 Minus
2R 25260384 2R 24615232..24615555 324..1 1620 100 Minus
2R 25260384 2R 24615113..24615171 382..324 295 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:11:42 has no hits.

LP09874.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:32 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20499913..20500236 1..324 100   Minus
chr2R 20496711..20497159 383..831 99 <- Minus
chr2R 20499794..20499851 325..382 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:11 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..624 82..705 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:00:19 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..624 82..705 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:12:41 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..624 82..705 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:53 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..624 82..705 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:04 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..624 82..705 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:17:31 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:00:19 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:12:41 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 18..848 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:53 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:04 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
CG4741-RA 18..848 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:32 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24610834..24611282 383..831 100 <- Minus
2R 24613914..24613971 325..382 100 <- Minus
2R 24614033..24614356 1..324 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:32 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24610834..24611282 383..831 100 <- Minus
2R 24613914..24613971 325..382 100 <- Minus
2R 24614033..24614356 1..324 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:32 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24610834..24611282 383..831 100 <- Minus
2R 24613914..24613971 325..382 100 <- Minus
2R 24614033..24614356 1..324 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:12:41 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20498357..20498805 383..831 100 <- Minus
arm_2R 20501437..20501494 325..382 100 <- Minus
arm_2R 20501556..20501879 1..324 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:39 Download gff for LP09874.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24615250..24615573 1..324 100   Minus
2R 24612051..24612499 383..831 100 <- Minus
2R 24615131..24615188 325..382 100 <- Minus

LP09874.hyp Sequence

Translation from 0 to 704

> LP09874.hyp
SALSVRQRTAVFETFFSSNQELTPEFNMAPAINATVSTPFDSTTVANGTL
NTTESTTSDWEYVNTTSVTIWINGGGYDGPYMLFYPSYVIYIVLVFLFVI
AFPLAMIMSAKRKRETNVRNLAQQRQRARRQMEINVTNNCNGGSGGVGNV
CSNSQNEVSVLPKTLDLPPSYDEAAFSERKQDSTLTIATSLEASNPNLAV
GINEPPPVYEANVATTTTSTTTTVFLVNGQPPVV*

LP09874.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4741-PA 207 CG4741-PA 1..207 28..234 1066 100 Plus
CG4741-PB 148 CG4741-PB 6..148 89..234 569 78.8 Plus
CG4741-PC 103 CG4741-PC 1..103 132..234 530 100 Plus

LP09874.pep Sequence

Translation from 81 to 704

> LP09874.pep
MAPAINATVSTPFDSTTVANGTLNTTESTTSDWEYVNTTSVTIWINGGGY
DGPYMLFYPSYVIYIVLVFLFVIAFPLAMIMSAKRKRETNVRNLAQQRQR
ARRQMEINVTNNCNGGSGGVGNVCSNSQNEVSVLPKTLDLPPSYDEAAFS
ERKQDSTLTIATSLEASNPNLAVGINEPPPVYEANVATTTTSTTTTVFLV
NGQPPVV*

LP09874.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11920-PA 215 GF11920-PA 1..215 1..207 550 63.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19910-PA 208 GG19910-PA 1..208 1..207 798 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21576-PA 143 GH21576-PA 5..117 85..183 261 54 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4741-PA 207 CG4741-PA 1..207 1..207 1066 100 Plus
CG4741-PB 148 CG4741-PB 6..148 62..207 569 78.8 Plus
CG4741-PC 103 CG4741-PC 1..103 105..207 530 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19548-PA 217 GI19548-PA 59..193 57..186 283 51.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10104-PA 210 GL10104-PA 1..210 1..207 429 57.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18396-PA 210 GA18396-PA 1..210 1..207 410 55 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11811-PA 207 GM11811-PA 1..207 1..207 811 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24935-PA 206 GD24935-PA 1..206 1..207 805 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21120-PA 221 GJ21120-PA 56..194 54..186 340 50.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21879-PA 215 GK21879-PA 1..196 1..183 384 50.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11433-PA 264 GE11433-PA 58..264 1..207 844 88.9 Plus