Clone LP09906 Report

Search the DGRC for LP09906

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:99
Well:6
Vector:pOT2
Associated Gene/TranscriptLysX-RA
Protein status:LP09906.pep: gold
Preliminary Size:565
Sequenced Size:582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9120 2002-01-01 Sim4 clustering to Release 2
CG9120 2002-05-18 Blastp of sequenced clone
CG9120 2003-01-01 Sim4 clustering to Release 3
LysX 2008-04-29 Release 5.5 accounting
LysX 2008-08-15 Release 5.9 accounting
LysX 2008-12-18 5.12 accounting

Clone Sequence Records

LP09906.complete Sequence

582 bp (582 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119081

> LP09906.complete
ATTCGCCATGAGAGCCCTCCTAGGAATCTGTGTCCTGGCACTAGTCACTC
CAGCTGTCCTGGGTCGCACCATGGATCGCTGCTCACTGGCGCGCGAGATG
GCCAATATGGGTGTTTCTCGTGACCAGTTGTCCAAGTGGGCGTGCATTGC
AGAGCACGAGAGCTCCTACCGCACCGGAGTGGTGGGGCCTCCCAACACCG
ATGGATCCAACGACTATGGCATTTTCCAGATCAACGACATGTACTGGTGC
CAGCCGTCCAGTGGAAAGTTCTCCCACAATGGCTGCGATGTGAGTTGCAA
CGCTCTCTTGACCGATGACATCAAAAGTTCCGTAAGATGTGCCCTAAAGG
TCCTGGGTCAACAGGGCTGGTCAGCCTGGTCCACCTGGCACTACTGCAGT
GGATACCTGCCCCCGATCGATGATTGCTTTGTTTAATTCAAGTCTCTTAA
CCATGGACATTTCAAAATGTAATTGTTTTGCAATCTAATAAACACTTTTT
ATACGTTTATACTTTTTGATACGTTGATTCACGATATATACATAAATAAA
AGTAAATATCTGGTAAAAAAAAAAAAAAAAAA

LP09906.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
LysX-RA 564 LysX-RA 1..564 1..564 2820 100 Plus
LysS-RA 472 LysS-RA 59..250 62..253 465 82.8 Plus
LysE-RA 490 LysE-RA 80..268 62..250 390 80.4 Plus
LysE-RA 490 LysE-RA 287..447 269..429 265 77.6 Plus
LysS-RA 472 LysS-RA 263..423 269..429 205 75.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1194274..1194837 564..1 2640 97.9 Minus
chr3L 24539361 chr3L 1206967..1207334 62..429 625 78 Plus
chr3L 24539361 chr3L 1210265..1210632 429..62 625 78 Minus
chr3L 24539361 chr3L 1212519..1212886 62..429 595 77.4 Plus
chr3L 24539361 chr3L 1227338..1227702 62..429 560 77.4 Plus
chr3L 24539361 chr3L 1210042..1210230 62..250 435 82 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1194738..1195302 565..1 2825 100 Minus
3L 28110227 3L 1207445..1207812 62..429 625 78 Plus
3L 28110227 3L 1210759..1211126 429..62 625 78 Minus
3L 28110227 3L 1213003..1213370 62..429 595 77.4 Plus
3L 28110227 3L 1227826..1228190 62..429 560 77.4 Plus
3L 28110227 3L 1210536..1210724 62..250 420 81.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1194738..1195302 565..1 2825 100 Minus
3L 28103327 3L 1227826..1228017 62..253 465 82.8 Plus
3L 28103327 3L 1210536..1210724 62..250 420 81.4 Plus
3L 28103327 3L 1213003..1213191 62..250 390 80.4 Plus
3L 28103327 3L 1207445..1207566 62..183 310 83.6 Plus
3L 28103327 3L 1211005..1211126 183..62 310 83.6 Minus
3L 28103327 3L 1207652..1207812 269..429 295 78.8 Plus
3L 28103327 3L 1210759..1210919 429..269 295 78.8 Minus
3L 28103327 3L 1213210..1213370 269..429 265 77.6 Plus
3L 28103327 3L 1228030..1228190 269..429 205 75.1 Plus
Blast to na_te.dros performed on 2019-03-15 22:05:26 has no hits.

LP09906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:06:35 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1194274..1194837 1..564 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:14 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..429 8..436 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:06:57 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..429 8..436 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:07:46 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..429 8..436 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:51:54 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..429 8..436 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:11:14 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..429 8..436 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:56:32 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:06:56 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:07:46 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:51:54 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..564 1..564 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:11:14 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
LysX-RA 1..564 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:35 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1194739..1195302 1..564 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:35 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1194739..1195302 1..564 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:35 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1194739..1195302 1..564 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:07:46 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1194739..1195302 1..564 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:26:46 Download gff for LP09906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1194739..1195302 1..564 100   Minus

LP09906.hyp Sequence

Translation from 0 to 435

> LP09906.hyp
FAMRALLGICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQLSKWACIA
EHESSYRTGVVGPPNTDGSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCN
ALLTDDIKSSVRCALKVLGQQGWSAWSTWHYCSGYLPPIDDCFV*

LP09906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
LysX-PA 142 CG9120-PA 1..142 3..144 785 100 Plus
LysB-PB 140 CG1179-PB 1..140 3..143 605 77.3 Plus
LysB-PA 140 CG1179-PA 1..140 3..143 605 77.3 Plus
LysC-PA 140 CG9111-PA 1..140 3..143 599 76.6 Plus
LysD-PA 140 CG9118-PA 1..140 3..143 596 75.9 Plus

LP09906.pep Sequence

Translation from 7 to 435

> LP09906.pep
MRALLGICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQLSKWACIAEH
ESSYRTGVVGPPNTDGSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNAL
LTDDIKSSVRCALKVLGQQGWSAWSTWHYCSGYLPPIDDCFV*

LP09906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10076-PA 142 GF10076-PA 1..141 1..141 599 75.9 Plus
Dana\GF10072-PA 140 GF10072-PA 18..140 19..141 556 82.1 Plus
Dana\GF24436-PA 140 GF24436-PA 18..140 19..141 554 81.3 Plus
Dana\GF10070-PA 141 GF10070-PA 1..141 1..141 550 67.4 Plus
Dana\GF24437-PA 140 GF24437-PA 1..140 1..141 538 72.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14620-PA 142 GG14620-PA 1..141 1..141 646 83 Plus
Dere\GG14615-PA 141 GG14615-PA 1..141 1..141 561 70.9 Plus
Dere\GG14617-PA 140 GG14617-PA 1..140 1..141 552 73 Plus
Dere\GG19822-PA 140 GG19822-PA 1..140 1..141 552 73 Plus
Dere\GG14762-PA 140 GG14762-PA 1..140 1..141 552 73 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15987-PA 140 GH15987-PA 18..140 19..141 543 77.2 Plus
Dgri\GH15989-PA 140 GH15989-PA 18..140 19..141 543 77.2 Plus
Dgri\GH15486-PA 140 GH15486-PA 18..140 19..141 534 76.4 Plus
Dgri\GH15485-PA 140 GH15485-PA 18..140 19..141 534 76.4 Plus
Dgri\GH15988-PA 143 GH15988-PA 9..143 6..141 455 62.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
LysX-PA 142 CG9120-PA 1..142 1..142 785 100 Plus
LysB-PB 140 CG1179-PB 1..140 1..141 605 77.3 Plus
LysB-PA 140 CG1179-PA 1..140 1..141 605 77.3 Plus
LysD-PA 140 CG9118-PA 1..140 1..141 596 75.9 Plus
LysE-PA 140 CG1180-PA 1..140 1..141 588 74.5 Plus
LysS-PA 140 CG1165-PA 1..140 1..141 577 70.9 Plus
LysP-PA 141 CG9116-PA 1..141 1..141 553 68.1 Plus
CG7798-PA 148 CG7798-PA 6..140 4..141 334 44.6 Plus
CG30062-PB 171 CG30062-PB 24..151 17..141 307 45.3 Plus
CG8492-PD 1360 CG8492-PD 438..552 19..128 235 39.3 Plus
CG8492-PD 1360 CG8492-PD 590..724 14..141 233 35.8 Plus
CG8492-PD 1360 CG8492-PD 184..297 19..127 211 36.4 Plus
CG8492-PD 1360 CG8492-PD 6..133 9..130 187 34.1 Plus
CG16756-PA 152 CG16756-PA 19..137 9..130 187 33.9 Plus
CG11159-PA 146 CG11159-PA 28..146 20..140 186 35.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16637-PA 140 GI16637-PA 18..140 19..141 536 78 Plus
Dmoj\GI16638-PA 140 GI16638-PA 18..140 19..141 536 78 Plus
Dmoj\GI16642-PA 140 GI16642-PA 18..140 19..141 533 76.4 Plus
Dmoj\GI16641-PA 144 GI16641-PA 9..143 7..141 531 72.6 Plus
Dmoj\GI16761-PA 140 GI16761-PA 17..140 18..141 530 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16082-PA 146 GL16082-PA 1..143 1..141 548 69.9 Plus
Dper\GL16159-PA 140 GL16159-PA 17..140 18..141 542 78.2 Plus
Dper\GL16083-PA 140 GL16083-PA 17..140 18..141 542 78.2 Plus
Dper\GL14512-PA 140 GL14512-PA 17..140 18..141 542 78.2 Plus
Dper\GL16156-PA 140 GL16156-PA 17..140 18..141 526 76.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28405-PA 140 GA28405-PA 1..140 1..141 568 73.8 Plus
Dpse\GA28485-PA 140 GA28485-PA 17..140 18..141 549 79.8 Plus
Dpse\GA11118-PA 141 GA11118-PA 1..141 1..141 542 69.7 Plus
Dpse\GA28409-PA 140 GA28409-PA 17..140 18..141 542 78.2 Plus
Dpse\GA28406-PA 140 GA28406-PA 17..140 18..141 542 78.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14382-PA 140 GM14382-PA 18..140 19..141 556 82.1 Plus
Dsec\GM14380-PA 140 GM14380-PA 1..140 1..141 554 73.8 Plus
Dsec\GM14229-PA 140 GM14229-PA 1..140 1..141 554 73.8 Plus
Dsec\GM14378-PA 140 GM14378-PA 1..140 1..141 553 73 Plus
Dsec\GM14233-PA 149 GM14233-PA 44..131 55..142 443 90.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13493-PA 160 GD13493-PA 1..142 1..142 714 93.7 Plus
Dsim\GD17618-PA 140 GD17618-PA 1..140 1..141 558 70.9 Plus
Dsim\GD17617-PA 140 GD17617-PA 1..140 1..141 558 70.9 Plus
Dsim\GD13594-PA 140 GD13594-PA 18..140 19..141 556 82.1 Plus
Dsim\GD13593-PA 140 GD13593-PA 1..140 1..141 553 73 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12508-PA 140 GJ12508-PA 1..140 1..141 579 75.2 Plus
Dvir\GJ12507-PA 140 GJ12507-PA 1..140 1..141 579 75.2 Plus
Dvir\GJ12895-PA 140 GJ12895-PA 1..140 1..141 575 73.8 Plus
Dvir\GJ12893-PA 140 GJ12893-PA 1..140 1..141 560 70.9 Plus
Dvir\GJ12894-PA 143 GJ12894-PA 1..142 1..141 554 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21106-PA 141 GK21106-PA 15..141 14..141 554 80.5 Plus
Dwil\GK21095-PA 141 GK21095-PA 15..141 14..141 554 80.5 Plus
Dwil\GK12154-PA 141 GK12154-PA 1..141 1..141 548 73.8 Plus
Dwil\GK21084-PA 141 GK21084-PA 1..141 1..141 548 73.8 Plus
Dwil\GK12260-PA 141 GK12260-PA 1..141 1..141 548 73.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20981-PA 142 GE20981-PA 1..141 1..141 652 84.4 Plus
Dyak\GE20976-PA 141 GE20976-PA 1..141 1..141 565 71.6 Plus
Dyak\GE20977-PA 140 GE20977-PA 1..140 1..141 555 73.8 Plus
Dyak\GE21124-PA 140 GE21124-PA 1..140 1..141 555 73.8 Plus
Dyak\LysS-PA 140 GE21126-PA 1..140 1..141 552 70.2 Plus