Clone LP09908 Report

Search the DGRC for LP09908

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:99
Well:8
Vector:pOT2
Associated Gene/TranscriptCG11095-RA
Protein status:LP09908.pep: gold
Preliminary Size:1314
Sequenced Size:1124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11095 2001-01-01 Release 2 assignment
CG11095 2003-01-01 Sim4 clustering to Release 3
CG11095 2003-03-19 Blastp of sequenced clone
CG11095 2008-04-29 Release 5.5 accounting
CG11095 2008-08-15 Release 5.9 accounting
CG11095 2008-12-18 5.12 accounting

Clone Sequence Records

LP09908.complete Sequence

1124 bp (1124 high quality bases) assembled on 2003-03-19

GenBank Submission: AY061558

> LP09908.complete
TTCGTTGCGTTCGCATTTGTTTACATCATTGCTCGATTCGGTGTTCTATA
GCCAAAAACGATGTCCCTGATTGCCCAGGCGAGTCGCACAGTGCCGCAGC
TACTGTTGCACTTGAACCGCCATCTGGTCACCTCCTGCTCAAGCGCCGCA
TCCGCCACGTCCTCGAAACCGCCGGATGTCGACCAGTCGATCACTGCCGA
CCAGCTCCTCGGACCGGAATCGCAGCGCAGGTGCATGGAGAAGATGCGCA
GCCTGCCGGCATTCCCGCGTCCCAAGGCGCTCACGCCCAGTCGCCGGGAA
AAGCAGACATCCGCGGTTCTTATCGCCCTCTGCCAGGAGCGCGGCACGAA
TGAAATATCCCTACTATACACCCGACGATCGCGACACCTGCGCAGCCACA
GCTTTCAGATCTCCTTTCCGGGCGGAAGGCGCGATGATCACGACTCGAGC
TACGTGGACTGTGCGCTGCGCGAAACAGAGGAGGAGATCGGCCTACCGCG
CCATCGCATCCAGGTGTGGGGCGAGGCCAAGCAGCTACAGCTGCCGAGGA
CCTCGTCGATTGTGCCAGTGGTGGGCGTGGTGCCGGACTTTAGCCTCTCC
GAGCTGCGTCTCAACTGGGAGGAGGTGGAGGAGGCGTTTAGTGTGCCGCT
CACTTCGCTAATGCTGCCCAAGGCCACCAGGCACACACAGTTTCGTAGCG
GCTACAGCGGTCCAGTATTTGTTGTAGACCATTATCGCATCTGGGGCATC
ACCGGCTATCTGACGCACCTCTTCCTGCACTGCCTGCTGCCACCCAATTT
GCTGCCCGATTGCCTCAAGACGAACATCAAGTTCATTCGGCCCTTTAAGC
TACCGCCCAAGCTGCCGCATCATCGCGAGCACTCCGCCGGGGATCCCTCG
ATGCGCACCTGACGAGACATCCGCGATCCGCCGACCGTAATCCTACTCAG
GCTAGCAACAATCTGGTACTGTGATTGGGCCAAATGTGCTTCGCTCGAAC
CGAACAATTGGCCAATTCTGATGGTGTTCTTTGTTTTAGTGTACGCGTTA
ATTGTTAATTCTCGGAGAGATTTATAATAAAACTGTTGACCATTATGTTG
AAATCGAAAAAAAAAAAAAAAAAA

LP09908.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11095-RA 1309 CG11095-RA 40..1147 1..1108 5540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13702840..13703598 348..1106 3765 99.7 Plus
chrX 22417052 chrX 13702427..13702774 1..348 1725 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13812112..13812872 348..1108 3805 100 Plus
X 23542271 X 13811699..13812046 1..348 1740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13820210..13820970 348..1108 3805 100 Plus
X 23527363 X 13819797..13820144 1..348 1740 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:11:44 has no hits.

LP09908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:33 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13702427..13702773 1..347 99 -> Plus
chrX 13702840..13703598 348..1106 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:15 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..852 61..912 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:11 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..852 61..912 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:12:44 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..852 61..912 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:38 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..852 61..912 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:06 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..852 61..912 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:31 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..1106 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:11 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..1106 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:12:44 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 16..1121 1..1106 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:38 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 1..1106 1..1106 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:06 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
CG11095-RA 16..1121 1..1106 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:33 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
X 13811699..13812045 1..347 100 -> Plus
X 13812112..13812870 348..1106 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:33 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
X 13811699..13812045 1..347 100 -> Plus
X 13812112..13812870 348..1106 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:33 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
X 13811699..13812045 1..347 100 -> Plus
X 13812112..13812870 348..1106 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:12:44 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13705732..13706078 1..347 100 -> Plus
arm_X 13706145..13706903 348..1106 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:46 Download gff for LP09908.complete
Subject Subject Range Query Range Percent Splice Strand
X 13819797..13820143 1..347 100 -> Plus
X 13820210..13820968 348..1106 100   Plus

LP09908.pep Sequence

Translation from 60 to 911

> LP09908.pep
MSLIAQASRTVPQLLLHLNRHLVTSCSSAASATSSKPPDVDQSITADQLL
GPESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEIS
LLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRI
QVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSL
MLPKATRHTQFRSGYSGPVFVVDHYRIWGITGYLTHLFLHCLLPPNLLPD
CLKTNIKFIRPFKLPPKLPHHREHSAGDPSMRT*

LP09908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19212-PA 303 GF19212-PA 12..302 7..282 1023 69.4 Plus
Dana\GF19213-PA 291 GF19213-PA 58..290 49..282 770 66.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17816-PA 283 GG17816-PA 1..283 1..283 1391 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24896-PA 260 GH24896-PA 14..254 27..271 877 66.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11095-PA 283 CG11095-PA 1..283 1..283 1484 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10896-PA 268 GI10896-PA 15..262 26..271 881 65.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14820-PA 279 GL14820-PA 3..277 1..281 1026 71.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10756-PA 278 GA10756-PA 3..276 1..281 1017 71.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17644-PA 283 GM17644-PA 1..283 1..283 1467 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17148-PA 283 GD17148-PA 1..283 1..283 1461 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18543-PA 275 GJ18543-PA 23..268 23..271 896 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10080-PA 283 GK10080-PA 21..280 15..278 889 62.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17111-PA 284 GE17111-PA 1..284 1..283 1324 93.7 Plus

LP09908.hyp Sequence

Translation from 60 to 911

> LP09908.hyp
MSLIAQASRTVPQLLLHLNRHLVTSCSSAASATSSKPPDVDQSITADQLL
GPESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEIS
LLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRI
QVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSL
MLPKATRHTQFRSGYSGPVFVVDHYRIWGITGYLTHLFLHCLLPPNLLPD
CLKTNIKFIRPFKLPPKLPHHREHSAGDPSMRT*

LP09908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11095-PA 283 CG11095-PA 1..283 1..283 1484 100 Plus