Clone LP10147 Report

Search the DGRC for LP10147

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:101
Well:47
Vector:pOT2
Associated Gene/TranscriptSkpF-RA
Protein status:LP10147.pep: gold
Preliminary Size:693
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12227 2002-01-01 Sim4 clustering to Release 2
CG12227 2002-06-04 Blastp of sequenced clone
CG12227 2003-01-01 Sim4 clustering to Release 3
skpF 2008-04-29 Release 5.5 accounting
skpF 2008-08-15 Release 5.9 accounting
skpF 2008-12-18 5.12 accounting

Clone Sequence Records

LP10147.complete Sequence

710 bp (710 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118610

> LP10147.complete
AGATTTTCTTGAAAAGTTGAACTGTACCAGATAACCTTAAAGGAAAACCC
TTTGTGGGCGAAAACGGACCATGCCAGTCATCAAATTGCAGTCCTCCGAT
GGCGAAATTTTCGAGACCGACATCGAGACTGCCAAGTGCTCGAGCACCAT
TAAGACCCTATTGGAGGATTGTCCAGTGGAAGCGGAGAACGACACTCTTA
TCCCGCTGCCCAATGTGAACTCGACGATCCTGAAGAAGGTCCTCATTTGG
GCCAAGCATCATCGCGAGGACATTGCAGAGGAGAACGAAGAGGAAGCGGC
CAAGTCCGTCGCTGTGCAGATCACCCCCTGGGACGCCGAGTTCCTGTCCA
TGGATCAGGGCACGCTCTTCGAACTCATCTTGGCGGCCAACTACCTGGAC
ATTCCCAATCTGCTGAACGCCGCCTGCATGACGGTGGCCAACATGATTAA
AGGCCGCACGACGGAGGAGATTCGCCAGACCTTTCACATAACCAACGATT
TCTCGCCCTCCGAGGAGGATTTGATGACGATGGAGTCGGAAGTCCCGCAG
GAGGACGAGGCGATAGAGTACGGCGAAATTATATAAATTCGAAGTGAACA
TTTTCGAAGGATTGATGCCTGTTCCGGATTAGAATGTAACTCGACATCCT
TACCTATGCTCACAAAATATCACATAAATATCCTTCATATGTAAAAAAAA
AAAAAAAAAA

LP10147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
skpF-RA 697 skpF-RA 4..696 1..693 3465 100 Plus
CG5357.a 2666 CG5357.a 2120..2666 693..147 2735 100 Minus
CG5357-RA 2636 CG5357-RA 2090..2636 693..147 2735 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19344345..19345036 692..1 3400 99.4 Minus
chr2R 21145070 chr2R 8026747..8026845 454..356 195 79.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23458064..23458756 693..1 3465 100 Minus
2R 25286936 2R 12139544..12139642 454..356 195 79.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23459263..23459955 693..1 3465 100 Minus
2R 25260384 2R 12140743..12140841 454..356 195 79.7 Minus
Blast to na_te.dros performed on 2019-03-16 11:25:53 has no hits.

LP10147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:26:42 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19344345..19345036 1..692 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:26 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:39 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:36:01 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:23:17 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:09 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
SkpF-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:11 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 4..695 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:39 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 4..695 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:36:01 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 4..695 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:23:17 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
skpF-RA 4..695 1..692 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:09 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
SkpF-RA 4..695 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:42 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23458065..23458756 1..692 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:42 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23458065..23458756 1..692 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:42 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23458065..23458756 1..692 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:36:01 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19345588..19346279 1..692 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:39 Download gff for LP10147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23459282..23459973 1..692 100   Minus

LP10147.pep Sequence

Translation from 70 to 585

> LP10147.pep
MPVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVN
STILKKVLIWAKHHREDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLF
ELILAANYLDIPNLLNAACMTVANMIKGRTTEEIRQTFHITNDFSPSEED
LMTMESEVPQEDEAIEYGEII*

LP10147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11848-PA 179 GF11848-PA 1..179 1..170 567 63.5 Plus
Dana\GF21176-PA 248 GF21176-PA 1..163 1..162 501 59.5 Plus
Dana\GF11136-PA 161 GF11136-PA 1..160 1..161 456 55.9 Plus
Dana\GF12644-PA 161 GF12644-PA 1..160 1..161 443 55.3 Plus
Dana\GF21823-PA 200 GF21823-PA 1..133 3..123 158 30.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20030-PA 170 GG20030-PA 1..170 1..170 726 81.2 Plus
Dere\GG12805-PA 162 GG12805-PA 1..161 1..161 504 59.6 Plus
Dere\GG22608-PA 162 GG22608-PA 1..160 1..161 451 56.4 Plus
Dere\GG19259-PA 157 GG19259-PA 3..144 1..142 411 53.5 Plus
Dere\GG20001-PA 160 GG20001-PA 1..138 3..136 143 22.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19712-PA 162 GH19712-PA 1..161 1..161 506 59 Plus
Dgri\GH24518-PA 162 GH24518-PA 1..161 1..161 499 58.4 Plus
Dgri\GH20861-PA 162 GH20861-PA 1..161 1..161 453 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
SkpF-PA 171 CG12227-PA 1..171 1..171 873 100 Plus
SkpA-PI 162 CG16983-PI 1..161 1..161 506 60.2 Plus
SkpA-PH 162 CG16983-PH 1..161 1..161 506 60.2 Plus
SkpA-PA 162 CG16983-PA 1..161 1..161 506 60.2 Plus
SkpA-PD 162 CG16983-PD 1..161 1..161 506 60.2 Plus
SkpA-PG 162 CG16983-PG 1..161 1..161 506 60.2 Plus
SkpA-PB 162 CG16983-PB 1..161 1..161 506 60.2 Plus
SkpA-PC 162 CG16983-PC 1..161 1..161 506 60.2 Plus
SkpA-PF 162 CG16983-PF 1..161 1..161 506 60.2 Plus
SkpA-PE 162 CG16983-PE 1..161 1..161 506 60.2 Plus
SkpB-PA 161 CG8881-PA 1..156 1..157 436 56.1 Plus
SkpD-PA 158 CG12700-PA 4..146 2..143 378 51.7 Plus
SkpC-PA 158 CG11941-PA 4..146 2..143 374 51.7 Plus
SkpE-PA 167 CG11942-PA 4..150 2..147 315 45.6 Plus
CG15800-PA 157 CG15800-PA 1..114 3..112 157 27.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15084-PA 162 GI15084-PA 1..161 1..161 502 59 Plus
Dmoj\GI20969-PA 162 GI20969-PA 1..161 1..161 462 56.2 Plus
Dmoj\GI11198-PA 148 GI11198-PA 1..139 1..140 373 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13359-PA 162 GL13359-PA 1..161 1..161 502 59.6 Plus
Dper\GL13358-PA 162 GL13358-PA 1..161 1..161 502 59.6 Plus
Dper\GL14141-PA 162 GL14141-PA 1..161 1..161 502 59.6 Plus
Dper\GL15335-PA 162 GL15335-PA 1..161 1..161 501 59.6 Plus
Dper\GL27172-PA 164 GL27172-PA 1..163 1..161 480 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14255-PA 162 GA14255-PA 1..161 1..161 502 59.6 Plus
Dpse\GA26756-PA 164 GA26756-PA 1..163 1..161 483 56.4 Plus
Dpse\GA21386-PA 162 GA21386-PA 1..157 1..157 468 60.1 Plus
Dpse\GA26757-PA 164 GA26757-PA 1..152 1..150 454 57.9 Plus
Dpse\GA24828-PA 169 GA24828-PA 1..155 1..151 424 54.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15542-PA 170 GM15542-PA 1..170 1..170 780 92.9 Plus
Dsec\GM19084-PA 162 GM19084-PA 1..161 1..161 507 60.2 Plus
Dsec\GM20386-PA 161 GM20386-PA 1..156 1..157 440 55.4 Plus
Dsec\GM22995-PA 168 GM22995-PA 15..157 3..144 340 47.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25046-PA 170 GD25046-PA 1..170 1..170 776 92.4 Plus
Dsim\GD16521-PA 162 GD16521-PA 1..161 1..161 507 60.2 Plus
Dsim\GD25859-PA 161 GD25859-PA 1..156 1..157 443 56.1 Plus
Dsim\GD25861-PA 128 GD25861-PA 6..123 40..157 341 55.9 Plus
Dsim\GD17469-PA 157 GD17469-PA 15..157 3..144 333 45.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18891-PA 200 GJ18891-PA 39..199 1..161 503 59 Plus
Dvir\GJ20688-PA 162 GJ20688-PA 1..161 1..161 462 56.8 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 1..141 1..140 401 54.6 Plus
Dvir\GJ22314-PA 140 GJ22314-PA 1..137 1..149 291 44.3 Plus
Dvir\GJ12411-PA 159 GJ12411-PA 8..151 4..140 136 28.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16428-PA 162 GK16428-PA 1..161 1..161 495 59 Plus
Dwil\GK23055-PA 154 GK23055-PA 1..154 1..157 492 61.4 Plus
Dwil\GK21342-PA 161 GK21342-PA 1..160 1..161 459 57.1 Plus
Dwil\GK21211-PA 162 GK21211-PA 1..157 1..157 438 54.1 Plus
Dwil\GK10153-PA 166 GK10153-PA 1..152 1..152 425 55.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11566-PA 172 GE11566-PA 1..172 1..170 699 78.6 Plus
Dyak\skpA-PA 162 GE16631-PA 1..161 1..161 505 59.6 Plus
Dyak\GE13476-PA 162 GE13476-PA 1..160 1..161 449 55.9 Plus
Dyak\GE11534-PA 194 GE11534-PA 35..172 3..136 144 23.8 Plus

LP10147.hyp Sequence

Translation from 70 to 585

> LP10147.hyp
MPVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVN
STILKKVLIWAKHHREDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLF
ELILAANYLDIPNLLNAACMTVANMIKGRTTEEIRQTFHITNDFSPSEED
LMTMESEVPQEDEAIEYGEII*

LP10147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
SkpF-PA 171 CG12227-PA 1..171 1..171 873 100 Plus
SkpA-PI 162 CG16983-PI 1..161 1..161 506 60.2 Plus
SkpA-PH 162 CG16983-PH 1..161 1..161 506 60.2 Plus
SkpA-PA 162 CG16983-PA 1..161 1..161 506 60.2 Plus
SkpA-PD 162 CG16983-PD 1..161 1..161 506 60.2 Plus