Clone LP10445 Report

Search the DGRC for LP10445

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:104
Well:45
Vector:pOT2
Associated Gene/TranscriptCG8300-RA
Protein status:LP10445.pep: gold
Preliminary Size:1148
Sequenced Size:1063

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8300 2001-01-01 Release 2 assignment
CG8300 2003-01-01 Sim4 clustering to Release 3
CG8300 2003-03-19 Blastp of sequenced clone
CG8300 2008-04-29 Release 5.5 accounting
CG8300 2008-08-15 Release 5.9 accounting
CG8300 2008-12-18 5.12 accounting

Clone Sequence Records

LP10445.complete Sequence

1063 bp (1063 high quality bases) assembled on 2003-03-19

GenBank Submission: AY069749

> LP10445.complete
TTTGCACCTAACTGCGCCAAGCGCCCCATGGCACGCGATTCTCGCCGTTT
GTGAGTCGTTTCGCCGGTGGCCCCCAACCCAAGGACATTTTGGCCCCCAG
CCGGCCGTATACGCATTTGGCGTTGACCCGCGTCCGCTTTTTTCATGACC
AAAACGGCGGCTGCGATTCAAACGAAGCTCAAGCGCAAGCAAAAACATTC
GCGCAGCGTCAATCAATCGAGGCGGTACTTAATCGGGTTTAGAGCTATCC
ATAGCCATGTCAGCGGAGAGGAACAAGAGTGGCGAAGTACGCAGTGCAGC
TGGAGGATTGGAACTGGCATCTGCGAGTGGAGCAAGTGCATCCGAGACGG
ACAATGTGAGCGCCCTTGAACTGCAGTCCAACAAGCGCATGCTGTACTTT
AGCGACGGCGTCATGGAGGAGTTGTCCTCGGGCAGCGAGGACGAGGCGGA
TGCGGAAATGGGCGACAAATGCTACGACGTCCATTTAAACGAGAGCGAAA
TGCCGCTGGGACCACGCCTGCGTTACAAGGCCAGCAGGATGGGCAACCGA
TTCCTGGCCGGCATCGACTATGTGGGCGGTGGGCTGGCCCACCTGCTTGG
TATCACCAGCAGCAAGTATGCCAGCGAATTGGAGAACTACCACAGGGCCA
AGGAGCACGGCGACGAGGACCTTGACAATTGGCACCCGCGGGCCATGTCG
ACCACGACCAGTAGCAGCAACAACAACAGCAGCGGCAACAACAATCGCAA
CGAAACCATCGTCCTATGCGAACCAACACGCAGCGAGGCGACCTTGCCAC
CCACACGGCAGTAGGCGCCCACTGGGCCACCCACTTGCCAGGTGGGTTGT
GCAAGGTGGCGATTTTCTTGGCAGGAAGGCGAAACAAAATGCTCATGGAG
TACTGGCGACACTTGGAGACTCTTTTACTTGGTAAAAACCATGCGAAACG
AAATGAATCAAAACAGATATTAACTTTTCGACACTTTATTCGCTAGCAAA
TAAGTTATACATATACATATATGATAATAAAAAAAATACACATATAAAAA
AAAAAAAAAAAAA

LP10445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8300-RA 1173 CG8300-RA 95..1143 1..1049 5245 100 Plus
fz4-RA 3380 fz4-RA 3303..3380 1049..972 390 100 Minus
fz4.b 3560 fz4.b 3483..3560 1049..972 390 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6997782..6998335 492..1045 2770 100 Plus
chrX 22417052 chrX 6996891..6997383 1..493 2465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7105792..7106349 492..1049 2790 100 Plus
X 23542271 X 7104900..7105392 1..493 2465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7113890..7114447 492..1049 2790 100 Plus
X 23527363 X 7112998..7113490 1..493 2465 100 Plus
Blast to na_te.dros performed 2019-03-15 22:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2449..2562 701..811 175 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2682..2914 590..813 169 57.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2524..2682 602..760 166 60.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6881 600..760 158 60.5 Plus
roo 9092 roo DM_ROO 9092bp 1056..1107 698..749 152 76.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6768..6883 701..814 150 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1540..1605 713..778 150 69.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6732..6815 701..784 149 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2308..2417 707..814 147 64 Plus
roo 9092 roo DM_ROO 9092bp 1104..1163 701..760 147 71.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6819..6881 701..763 144 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2318..2395 699..778 143 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6750..6830 701..780 141 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2264..2452 599..778 139 57.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6729..6772 701..744 139 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2788..2838 707..757 138 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6796 713..786 135 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1549..1612 701..760 130 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6751 712..744 129 87.9 Plus
roo 9092 roo DM_ROO 9092bp 1110..1178 710..778 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2577..2626 695..743 121 74 Plus
TART-A 13424 TART-A 13424bp 897..942 697..741 119 76.1 Plus
TART-A 13424 TART-A 13424bp 12075..12120 697..741 119 76.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1591 715..792 118 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2438..2475 714..751 118 78.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1546..1599 701..754 117 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5649..5720 718..792 114 68.4 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 529..580 716..769 112 70.4 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 979..1011 701..733 111 81.8 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 1173..1246 962..1039 111 62.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6920 600..751 110 55.8 Plus

LP10445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:35:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6996891..6997383 1..493 100 -> Plus
chrX 6997784..6998318 494..1028 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:36 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..558 257..814 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:12 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..558 257..814 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..558 257..814 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:39 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..558 257..814 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:44 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..558 257..814 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:33 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:12 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 16..1043 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:40 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:44 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
CG8300-RA 16..1043 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
X 7104900..7105392 1..493 100 -> Plus
X 7105794..7106328 494..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
X 7104900..7105392 1..493 100 -> Plus
X 7105794..7106328 494..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
X 7104900..7105392 1..493 100 -> Plus
X 7105794..7106328 494..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:45 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6998933..6999425 1..493 100 -> Plus
arm_X 6999827..7000361 494..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:47 Download gff for LP10445.complete
Subject Subject Range Query Range Percent Splice Strand
X 7112998..7113490 1..493 100 -> Plus
X 7113892..7114426 494..1028 100   Plus

LP10445.hyp Sequence

Translation from 256 to 813

> LP10445.hyp
MSAERNKSGEVRSAAGGLELASASGASASETDNVSALELQSNKRMLYFSD
GVMEELSSGSEDEADAEMGDKCYDVHLNESEMPLGPRLRYKASRMGNRFL
AGIDYVGGGLAHLLGITSSKYASELENYHRAKEHGDEDLDNWHPRAMSTT
TSSSNNNSSGNNNRNETIVLCEPTRSEATLPPTRQ*

LP10445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8300-PA 185 CG8300-PA 1..185 1..185 952 100 Plus

LP10445.pep Sequence

Translation from 256 to 813

> LP10445.pep
MSAERNKSGEVRSAAGGLELASASGASASETDNVSALELQSNKRMLYFSD
GVMEELSSGSEDEADAEMGDKCYDVHLNESEMPLGPRLRYKASRMGNRFL
AGIDYVGGGLAHLLGITSSKYASELENYHRAKEHGDEDLDNWHPRAMSTT
TSSSNNNSSGNNNRNETIVLCEPTRSEATLPPTRQ*

LP10445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21344-PA 181 GF21344-PA 16..181 19..185 509 66.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19634-PA 181 GG19634-PA 1..181 1..185 748 82.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24652-PA 172 GH24652-PA 9..172 30..185 411 55.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8300-PA 185 CG8300-PA 1..185 1..185 952 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11080-PA 174 GI11080-PA 17..174 29..185 403 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14687-PA 175 GL14687-PA 9..159 20..177 510 68.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20968-PA 183 GA20968-PA 1..171 18..181 477 64 Plus
Dpse\GA23719-PA 1010 GA23719-PA 1..148 18..157 444 64.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17507-PA 176 GM17507-PA 1..176 1..185 690 84.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16834-PA 176 GD16834-PA 1..176 1..185 867 91.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16391-PA 166 GJ16391-PA 19..165 30..184 414 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25121-PA 178 GK25121-PA 14..138 20..140 351 63.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15703-PA 185 GE15703-PA 23..185 19..185 729 86.2 Plus