BDGP Sequence Production Resources |
Search the DGRC for LP10549
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 105 |
Well: | 49 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30152-RA |
Protein status: | LP10549.pep: gold |
Preliminary Size: | 955 |
Sequenced Size: | 1006 |
Gene | Date | Evidence |
---|---|---|
CG10404 | 2002-01-01 | Sim4 clustering to Release 2 |
CG30152 | 2002-06-04 | Blastp of sequenced clone |
CG30152 | 2003-01-01 | Sim4 clustering to Release 3 |
CG30152 | 2008-04-29 | Release 5.5 accounting |
CG30152 | 2008-08-15 | Release 5.9 accounting |
CG30152 | 2008-12-18 | 5.12 accounting |
1006 bp (1006 high quality bases) assembled on 2002-06-04
GenBank Submission: AY118612
> LP10549.complete TCGGCAGAAAAACAATAATCAGCTGATGCCATCGCTTATTTCCAACAATT TGCACCGCAAAAGTGAAGAATTACCAAGCAAATAGATCGCCTGCCGACCG AATTATGCTGCTGTAATCACCCAAGCACACAACGGTAAAGATAAAACCAG GCGAGATAACACCACGCACAGGTGCCACAACATGCTGTCCTACATAAAGC GCAAGCTCTCCGAATCCGACAGCGGCGTCAGTTCGGTCGCAACTGTGACG TCGTCGTGCGGCGGCGATAGTGGGAGAGCGGGCGGAACGGGCAGCAGTGA AAGCGGTACGGGCAGCAGCAGCGCCAGTATCAGCGGACGCAGCCAGAACG CCGACGAGTTAGTGCGCAAAACGAGCCAGATGTCGATGGATGATGAGGCC ATTGCCTTCGGGGAGGACGCACTGCTCCATGAACTGGGCTACAAGAATCA GACGGAACTGCAGGAAACCATCTACGATCTGTTGCGCGGCATTCGCGATC CCGAGAAGCCGTGCACTTTGGAGGACCTCAACGTTGTCTACGAGGATGGA ATCTTTGTGATGCCGCCCACGCGCTCCAATGTCTCAGTTGTTCGCATCGA GTTTAACCCCACAGTGCCACATTGCTCGTTGGCCACGCTTATTGGACTCT GTATACGCGTGAAAGTAGAACGCGGACTTCCGCACAACATAAAGCTAGAC ATATACATCAAGAAGGGAGCGCATCAAACCGAGGAAGAGATTAACAAGCA AATCAATGACAAGGAGCGCATCGCTGCGGCCATGGAGAACCCCAATCTGA GGGATTTGGTCGAGAACTGCATCAAGGATGAGGAGTAGCTCTCTTTGCCA TATCTTTTGTACATAGGGAATACTTTGAGGAATGTCTAGGATTAAGTGTA CCATTAAGTTGCATCAGGGAGTGTGTGCTTAGCATTAAAGCCCTTAAAAT CTGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 16557904..16558379 | 1..476 | 2380 | 100 | Plus |
chr2R | 21145070 | chr2R | 16559029..16559243 | 741..955 | 1060 | 99.5 | Plus |
chr2R | 21145070 | chr2R | 16558808..16558962 | 590..744 | 760 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 16558434..16558549 | 476..591 | 580 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 20671203..20671678 | 1..476 | 2380 | 100 | Plus |
2R | 25286936 | 2R | 20672340..20672556 | 741..957 | 1085 | 100 | Plus |
2R | 25286936 | 2R | 20672119..20672273 | 590..744 | 760 | 99.4 | Plus |
2R | 25286936 | 2R | 20671745..20671860 | 476..591 | 580 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 20672402..20672877 | 1..476 | 2380 | 100 | Plus |
2R | 25260384 | 2R | 20673539..20673755 | 741..957 | 1085 | 100 | Plus |
2R | 25260384 | 2R | 20673318..20673472 | 590..744 | 760 | 99.3 | Plus |
2R | 25260384 | 2R | 20672944..20673059 | 476..591 | 580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16557904..16558379 | 1..476 | 100 | -> | Plus |
chr2R | 16558435..16558547 | 477..589 | 100 | -> | Plus |
chr2R | 16558808..16558958 | 590..740 | 100 | -> | Plus |
chr2R | 16559029..16559243 | 741..955 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..657 | 182..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..657 | 182..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..657 | 182..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..657 | 182..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..657 | 182..838 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..955 | 1..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..955 | 1..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..954 | 2..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RA | 1..955 | 1..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30152-RC | 519..1473 | 1..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20671203..20671678 | 1..476 | 100 | -> | Plus |
2R | 20671746..20671858 | 477..589 | 100 | -> | Plus |
2R | 20672119..20672269 | 590..740 | 100 | -> | Plus |
2R | 20672340..20672554 | 741..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20671203..20671678 | 1..476 | 100 | -> | Plus |
2R | 20671746..20671858 | 477..589 | 100 | -> | Plus |
2R | 20672119..20672269 | 590..740 | 100 | -> | Plus |
2R | 20672340..20672554 | 741..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20671203..20671678 | 1..476 | 100 | -> | Plus |
2R | 20671746..20671858 | 477..589 | 100 | -> | Plus |
2R | 20672119..20672269 | 590..740 | 100 | -> | Plus |
2R | 20672340..20672554 | 741..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16558708..16559183 | 1..476 | 100 | -> | Plus |
arm_2R | 16559251..16559363 | 477..589 | 100 | -> | Plus |
arm_2R | 16559624..16559774 | 590..740 | 100 | -> | Plus |
arm_2R | 16559845..16560059 | 741..955 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20672945..20673057 | 477..589 | 100 | -> | Plus |
2R | 20673318..20673468 | 590..740 | 100 | -> | Plus |
2R | 20673539..20673753 | 741..955 | 100 | Plus | |
2R | 20672402..20672877 | 1..476 | 100 | -> | Plus |
Translation from 181 to 837
> LP10549.pep MLSYIKRKLSESDSGVSSVATVTSSCGGDSGRAGGTGSSESGTGSSSASI SGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDL LRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSL ATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAA MENPNLRDLVENCIKDEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12194-PA | 207 | GF12194-PA | 1..207 | 1..218 | 853 | 79.4 | Plus |
Dana\GF10614-PA | 156 | GF10614-PA | 39..152 | 97..214 | 304 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22053-PA | 222 | GG22053-PA | 1..222 | 1..218 | 1088 | 94.1 | Plus |
Dere\GG15455-PA | 156 | GG15455-PA | 39..152 | 97..214 | 307 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21994-PA | 189 | GH21994-PA | 1..189 | 1..218 | 845 | 75.7 | Plus |
Dgri\GH23231-PA | 156 | GH23231-PA | 39..152 | 97..214 | 300 | 50.8 | Plus |
Dgri\GH14512-PA | 156 | GH14512-PA | 39..152 | 97..214 | 300 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
galla-1-PC | 218 | CG30152-PC | 1..218 | 1..218 | 1110 | 100 | Plus |
galla-1-PB | 218 | CG30152-PB | 1..218 | 1..218 | 1110 | 100 | Plus |
galla-1-PA | 218 | CG30152-PA | 1..218 | 1..218 | 1110 | 100 | Plus |
galla-1-PD | 152 | CG30152-PD | 1..152 | 67..218 | 792 | 100 | Plus |
galla-2-PA | 156 | CG7949-PA | 39..152 | 97..214 | 301 | 51.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19694-PA | 187 | GI19694-PA | 1..187 | 1..218 | 793 | 75.2 | Plus |
Dmoj\GI13290-PA | 156 | GI13290-PA | 39..152 | 97..214 | 303 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17044-PA | 211 | GL17044-PA | 1..211 | 1..218 | 860 | 82.6 | Plus |
Dper\GL21874-PA | 156 | GL21874-PA | 39..152 | 97..214 | 299 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15681-PA | 211 | GA15681-PA | 1..211 | 1..218 | 860 | 82.6 | Plus |
Dpse\GA20712-PA | 156 | GA20712-PA | 39..152 | 97..214 | 300 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22037-PA | 218 | GM22037-PA | 1..218 | 1..218 | 1123 | 97.7 | Plus |
Dsec\GM25231-PA | 156 | GM25231-PA | 39..152 | 97..214 | 303 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11534-PA | 218 | GD11534-PA | 1..218 | 1..218 | 1132 | 98.6 | Plus |
Dsim\GD14263-PA | 156 | GD14263-PA | 39..152 | 97..214 | 302 | 50.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17321-PA | 190 | GJ17321-PA | 1..190 | 1..218 | 852 | 76.6 | Plus |
Dvir\GJ12056-PA | 156 | GJ12056-PA | 39..152 | 97..214 | 305 | 50.8 | Plus |
Translation from 181 to 837
> LP10549.hyp MLSYIKRKLSESDSGVSSVATVTSSCGGDSGRAGGTGSSESGTGSSSASI SGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDL LRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSL ATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAA MENPNLRDLVENCIKDEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30152-PC | 218 | CG30152-PC | 1..218 | 1..218 | 1110 | 100 | Plus |
CG30152-PB | 218 | CG30152-PB | 1..218 | 1..218 | 1110 | 100 | Plus |
CG30152-PA | 218 | CG30152-PA | 1..218 | 1..218 | 1110 | 100 | Plus |
CG30152-PD | 152 | CG30152-PD | 1..152 | 67..218 | 792 | 100 | Plus |
CG7949-PA | 156 | CG7949-PA | 39..152 | 97..214 | 301 | 51.7 | Plus |