Clone LP10549 Report

Search the DGRC for LP10549

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:105
Well:49
Vector:pOT2
Associated Gene/TranscriptCG30152-RA
Protein status:LP10549.pep: gold
Preliminary Size:955
Sequenced Size:1006

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10404 2002-01-01 Sim4 clustering to Release 2
CG30152 2002-06-04 Blastp of sequenced clone
CG30152 2003-01-01 Sim4 clustering to Release 3
CG30152 2008-04-29 Release 5.5 accounting
CG30152 2008-08-15 Release 5.9 accounting
CG30152 2008-12-18 5.12 accounting

Clone Sequence Records

LP10549.complete Sequence

1006 bp (1006 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118612

> LP10549.complete
TCGGCAGAAAAACAATAATCAGCTGATGCCATCGCTTATTTCCAACAATT
TGCACCGCAAAAGTGAAGAATTACCAAGCAAATAGATCGCCTGCCGACCG
AATTATGCTGCTGTAATCACCCAAGCACACAACGGTAAAGATAAAACCAG
GCGAGATAACACCACGCACAGGTGCCACAACATGCTGTCCTACATAAAGC
GCAAGCTCTCCGAATCCGACAGCGGCGTCAGTTCGGTCGCAACTGTGACG
TCGTCGTGCGGCGGCGATAGTGGGAGAGCGGGCGGAACGGGCAGCAGTGA
AAGCGGTACGGGCAGCAGCAGCGCCAGTATCAGCGGACGCAGCCAGAACG
CCGACGAGTTAGTGCGCAAAACGAGCCAGATGTCGATGGATGATGAGGCC
ATTGCCTTCGGGGAGGACGCACTGCTCCATGAACTGGGCTACAAGAATCA
GACGGAACTGCAGGAAACCATCTACGATCTGTTGCGCGGCATTCGCGATC
CCGAGAAGCCGTGCACTTTGGAGGACCTCAACGTTGTCTACGAGGATGGA
ATCTTTGTGATGCCGCCCACGCGCTCCAATGTCTCAGTTGTTCGCATCGA
GTTTAACCCCACAGTGCCACATTGCTCGTTGGCCACGCTTATTGGACTCT
GTATACGCGTGAAAGTAGAACGCGGACTTCCGCACAACATAAAGCTAGAC
ATATACATCAAGAAGGGAGCGCATCAAACCGAGGAAGAGATTAACAAGCA
AATCAATGACAAGGAGCGCATCGCTGCGGCCATGGAGAACCCCAATCTGA
GGGATTTGGTCGAGAACTGCATCAAGGATGAGGAGTAGCTCTCTTTGCCA
TATCTTTTGTACATAGGGAATACTTTGAGGAATGTCTAGGATTAAGTGTA
CCATTAAGTTGCATCAGGGAGTGTGTGCTTAGCATTAAAGCCCTTAAAAT
CTGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

LP10549.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG30152-RA 1210 CG30152-RA 162..1118 1..957 4785 100 Plus
CG30152.a 1541 CG30152.a 162..1118 1..957 4785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16557904..16558379 1..476 2380 100 Plus
chr2R 21145070 chr2R 16559029..16559243 741..955 1060 99.5 Plus
chr2R 21145070 chr2R 16558808..16558962 590..744 760 99.4 Plus
chr2R 21145070 chr2R 16558434..16558549 476..591 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20671203..20671678 1..476 2380 100 Plus
2R 25286936 2R 20672340..20672556 741..957 1085 100 Plus
2R 25286936 2R 20672119..20672273 590..744 760 99.4 Plus
2R 25286936 2R 20671745..20671860 476..591 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20672402..20672877 1..476 2380 100 Plus
2R 25260384 2R 20673539..20673755 741..957 1085 100 Plus
2R 25260384 2R 20673318..20673472 590..744 760 99.3 Plus
2R 25260384 2R 20672944..20673059 476..591 580 100 Plus
Blast to na_te.dros performed 2019-03-16 12:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 660..724 353..290 151 72.3 Minus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 631..693 334..272 125 70.3 Minus

LP10549.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:24:18 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16557904..16558379 1..476 100 -> Plus
chr2R 16558435..16558547 477..589 100 -> Plus
chr2R 16558808..16558958 590..740 100 -> Plus
chr2R 16559029..16559243 741..955 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:42 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..657 182..838 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:32 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..657 182..838 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:19:38 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..657 182..838 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:58 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..657 182..838 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:44:26 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..657 182..838 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:00 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..955 1..955 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:32 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..955 1..955 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:19:38 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..954 2..955 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:58 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RA 1..955 1..955 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:44:26 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
CG30152-RC 519..1473 1..955 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:18 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20671203..20671678 1..476 100 -> Plus
2R 20671746..20671858 477..589 100 -> Plus
2R 20672119..20672269 590..740 100 -> Plus
2R 20672340..20672554 741..955 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:18 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20671203..20671678 1..476 100 -> Plus
2R 20671746..20671858 477..589 100 -> Plus
2R 20672119..20672269 590..740 100 -> Plus
2R 20672340..20672554 741..955 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:18 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20671203..20671678 1..476 100 -> Plus
2R 20671746..20671858 477..589 100 -> Plus
2R 20672119..20672269 590..740 100 -> Plus
2R 20672340..20672554 741..955 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:19:38 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16558708..16559183 1..476 100 -> Plus
arm_2R 16559251..16559363 477..589 100 -> Plus
arm_2R 16559624..16559774 590..740 100 -> Plus
arm_2R 16559845..16560059 741..955 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:31 Download gff for LP10549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20672945..20673057 477..589 100 -> Plus
2R 20673318..20673468 590..740 100 -> Plus
2R 20673539..20673753 741..955 100   Plus
2R 20672402..20672877 1..476 100 -> Plus

LP10549.pep Sequence

Translation from 181 to 837

> LP10549.pep
MLSYIKRKLSESDSGVSSVATVTSSCGGDSGRAGGTGSSESGTGSSSASI
SGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDL
LRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSL
ATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAA
MENPNLRDLVENCIKDEE*

LP10549.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12194-PA 207 GF12194-PA 1..207 1..218 853 79.4 Plus
Dana\GF10614-PA 156 GF10614-PA 39..152 97..214 304 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22053-PA 222 GG22053-PA 1..222 1..218 1088 94.1 Plus
Dere\GG15455-PA 156 GG15455-PA 39..152 97..214 307 52.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21994-PA 189 GH21994-PA 1..189 1..218 845 75.7 Plus
Dgri\GH23231-PA 156 GH23231-PA 39..152 97..214 300 50.8 Plus
Dgri\GH14512-PA 156 GH14512-PA 39..152 97..214 300 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
galla-1-PC 218 CG30152-PC 1..218 1..218 1110 100 Plus
galla-1-PB 218 CG30152-PB 1..218 1..218 1110 100 Plus
galla-1-PA 218 CG30152-PA 1..218 1..218 1110 100 Plus
galla-1-PD 152 CG30152-PD 1..152 67..218 792 100 Plus
galla-2-PA 156 CG7949-PA 39..152 97..214 301 51.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19694-PA 187 GI19694-PA 1..187 1..218 793 75.2 Plus
Dmoj\GI13290-PA 156 GI13290-PA 39..152 97..214 303 50.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17044-PA 211 GL17044-PA 1..211 1..218 860 82.6 Plus
Dper\GL21874-PA 156 GL21874-PA 39..152 97..214 299 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15681-PA 211 GA15681-PA 1..211 1..218 860 82.6 Plus
Dpse\GA20712-PA 156 GA20712-PA 39..152 97..214 300 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22037-PA 218 GM22037-PA 1..218 1..218 1123 97.7 Plus
Dsec\GM25231-PA 156 GM25231-PA 39..152 97..214 303 50.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11534-PA 218 GD11534-PA 1..218 1..218 1132 98.6 Plus
Dsim\GD14263-PA 156 GD14263-PA 39..152 97..214 302 50.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17321-PA 190 GJ17321-PA 1..190 1..218 852 76.6 Plus
Dvir\GJ12056-PA 156 GJ12056-PA 39..152 97..214 305 50.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21825-PA 191 GK21825-PA 1..191 1..218 859 76.6 Plus
Dwil\GK17777-PA 156 GK17777-PA 39..152 97..214 300 50.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12134-PA 224 GE12134-PA 1..224 1..218 935 85.7 Plus
Dyak\GE21767-PA 156 GE21767-PA 39..152 97..214 308 50.8 Plus

LP10549.hyp Sequence

Translation from 181 to 837

> LP10549.hyp
MLSYIKRKLSESDSGVSSVATVTSSCGGDSGRAGGTGSSESGTGSSSASI
SGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDL
LRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSL
ATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAA
MENPNLRDLVENCIKDEE*

LP10549.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30152-PC 218 CG30152-PC 1..218 1..218 1110 100 Plus
CG30152-PB 218 CG30152-PB 1..218 1..218 1110 100 Plus
CG30152-PA 218 CG30152-PA 1..218 1..218 1110 100 Plus
CG30152-PD 152 CG30152-PD 1..152 67..218 792 100 Plus
CG7949-PA 156 CG7949-PA 39..152 97..214 301 51.7 Plus