Clone LP10852 Report

Search the DGRC for LP10852

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:108
Well:52
Vector:pOT2
Associated Gene/TranscriptmRpS18B-RA
Protein status:LP10852.pep: gold
Preliminary Size:871
Sequenced Size:751

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10757 2001-01-01 Release 2 assignment
CG10757 2002-01-03 Blastp of sequenced clone
CG10757 2003-01-01 Sim4 clustering to Release 3
mRpS18B 2008-04-29 Release 5.5 accounting
mRpS18B 2008-08-15 Release 5.9 accounting
mRpS18B 2008-12-18 5.12 accounting

Clone Sequence Records

LP10852.complete Sequence

751 bp (751 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075438

> LP10852.complete
CCGAACCCAGGCGTCGGCGCTCTATTTTTTTATGGTGGCATCCAAATTAA
CTTCAGGTTTTATTCAATTAAAATGTTGCCGATTGCACGTGGAATTTACA
TTGGACTGGTCAACATTACCCGGAATAGCCGGGGAGCTCTTCACACGGCC
AGCGCCTTGAGATGCAAGGCGGAGACTTCGACTGAAGAAAATAATGCGGC
TGCCACCGAAGGCGAAGGCGAGGATAACGCTAGTGGTTCCGCACCAGACC
CGAAGGATCGCAGCAAACCAATCCCAGTGGAGACCTCGATTCGATACTTA
AAGAGCGCCGCTTACAAGCAAACCTACGGCGAGGACTTTGTGTGGACGCA
GTATCGGCGCAACCACAAGGGCATGTATGCGCCGCGCAAAACACGAAAGA
CGTGCATCCGCCAGAACCGTATCAGCACCGGAAATCCCTGTCCCATTTGC
CGTGATGAATACCTGGTGCTGGACTACCGCAACACGGAGCTCCTGGAGCA
GTTCATATCGCCCCACAGCGGAGACGTCCTTAGCTACTCAAAGACAGGCC
TGTGTCAAAAGAGCCACCTGCGTCTAATGGTCGCCGTTCAGCAAGCCCGC
GACTCCGGGTACCTAACATACGATGTGCCCTTCAGGGAGTATGATTACAG
CGAGTACTACGGCCAGGAGCAGAAGCAGAAAGCTTAACCAACTAATGATT
AACATGTTTTTATTAAAAGAAATTACTGTAAAAAAAAAAAAAAAAAAAAA
A

LP10852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18B-RA 729 mRpS18B-RA 1..729 1..729 3645 100 Plus
mRpS18B-RB 904 mRpS18B-RB 120..808 48..736 3430 99.8 Plus
mRpS18B.a 745 mRpS18B.a 381..744 369..732 1820 100 Plus
mRpS18B.a 745 mRpS18B.a 73..382 48..357 1550 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20094840..20095213 729..356 1840 99.5 Minus
chr2L 23010047 chr2L 20095274..20095583 357..48 1535 99.7 Minus
chr2L 23010047 chr2L 20096428..20096474 47..1 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20096424..20096804 736..356 1890 99.7 Minus
2L 23513712 2L 20096865..20097174 357..48 1550 100 Minus
2L 23513712 2L 20098019..20098065 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20096424..20096804 736..356 1890 99.7 Minus
2L 23513712 2L 20096865..20097174 357..48 1550 100 Minus
2L 23513712 2L 20098019..20098065 47..1 235 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:38:02 has no hits.

LP10852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:38:54 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20094840..20095212 357..729 99 <- Minus
chr2L 20095275..20095583 48..356 99 <- Minus
chr2L 20096428..20096474 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:52 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RB 1..615 73..687 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:02 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RB 1..615 73..687 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:19:03 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 1..615 73..687 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:33 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RB 1..615 73..687 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:05 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 1..615 73..687 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:12 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:02 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:19:03 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 77..761 45..729 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:33 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:05 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18B-RA 77..761 45..729 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:54 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20096431..20096803 357..729 100 <- Minus
2L 20096866..20097174 48..356 100 <- Minus
2L 20098019..20098065 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:54 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20096431..20096803 357..729 100 <- Minus
2L 20096866..20097174 48..356 100 <- Minus
2L 20098019..20098065 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:54 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20096431..20096803 357..729 100 <- Minus
2L 20096866..20097174 48..356 100 <- Minus
2L 20098019..20098065 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:19:03 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20096431..20096803 357..729 100 <- Minus
arm_2L 20096866..20097174 48..356 100 <- Minus
arm_2L 20098019..20098065 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:25 Download gff for LP10852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20096431..20096803 357..729 100 <- Minus
2L 20096866..20097174 48..356 100 <- Minus
2L 20098019..20098065 1..47 100   Minus

LP10852.hyp Sequence

Translation from 0 to 686

> LP10852.hyp
PNPGVGALFFYGGIQINFRFYSIKMLPIARGIYIGLVNITRNSRGALHTA
SALRCKAETSTEENNAAATEGEGEDNASGSAPDPKDRSKPIPVETSIRYL
KSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTGNPCPIC
RDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQAR
DSGYLTYDVPFREYDYSEYYGQEQKQKA*

LP10852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18B-PB 204 CG10757-PB 1..204 25..228 1079 100 Plus
mRpS18B-PA 204 CG10757-PA 1..204 25..228 1079 100 Plus

LP10852.pep Sequence

Translation from 72 to 686

> LP10852.pep
MLPIARGIYIGLVNITRNSRGALHTASALRCKAETSTEENNAAATEGEGE
DNASGSAPDPKDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKG
MYAPRKTRKTCIRQNRISTGNPCPICRDEYLVLDYRNTELLEQFISPHSG
DVLSYSKTGLCQKSHLRLMVAVQQARDSGYLTYDVPFREYDYSEYYGQEQ
KQKA*

LP10852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15452-PA 209 GF15452-PA 1..206 1..203 942 85.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21586-PA 204 GG21586-PA 1..204 1..204 1033 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13236-PA 205 GH13236-PA 1..199 1..201 802 73.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18B-PB 204 CG10757-PB 1..204 1..204 1079 100 Plus
mRpS18B-PA 204 CG10757-PA 1..204 1..204 1079 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12473-PA 203 GI12473-PA 1..202 1..203 854 78.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26668-PA 196 GL26668-PA 1..195 1..200 876 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29010-PA 200 GA29010-PA 1..199 1..200 833 79.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16961-PA 204 GM16961-PA 1..204 1..204 1059 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21714-PA 204 GD21714-PA 1..204 1..204 1059 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17885-PA 201 GJ17885-PA 1..200 1..203 804 75.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18744-PA 210 GK18744-PA 1..208 1..203 802 74.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12605-PA 204 GE12605-PA 1..204 1..204 1025 93.1 Plus