Clone LP10895 Report

Search the DGRC for LP10895

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:108
Well:95
Vector:pOT2
Associated Gene/TranscriptCG3505-RA
Protein status:LP10895.pep: gold
Preliminary Size:1299
Sequenced Size:1179

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3505 2001-01-01 Release 2 assignment
CG3505 2002-03-19 Blastp of sequenced clone
CG3505 2003-01-01 Sim4 clustering to Release 3
CG3505 2008-04-29 Release 5.5 accounting
CG3505 2008-08-15 Release 5.9 accounting
CG3505 2008-12-18 5.12 accounting

Clone Sequence Records

LP10895.complete Sequence

1179 bp (1179 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094840

> LP10895.complete
TATCGTATCTGATCGATCCGGTCCGGCATGGGAAGTTTTCCAGCTCTACT
TGTTGTTGTCGGCTCGCTGGCATTGGGCGCGAATGCTCAACTCCCGCCCA
TCAATTGTGTTGCAAAAATTCCGAGTGGCCGTGTCACCGGTCACTGCATT
TCGATCCGGGAGTGTGACTACTTCATGAGAATCCTGCTATCCGGCAATCT
CAGCCAGAGCGATCGCAACCTGCTCCGTGATAATCAGTGCGGAGTGCGGG
GCAACGACGTCCAGGTATGCTGTCCTAGTACCGCCGGCTTGGGTGCCCTG
ACCCACCCACTTTTGCCCTCGGATTGCGGAAAGGTTCGTTGGCAGCGTTC
GAATGACACAGATACGCGAATCCGGGAGTTTCCCTGGCTGGCCCTCATTG
AGTATACGCGCGGCAACCAGGAGAAGATCCATGCGTGTGGCGGTGTGCTT
ATCAGTGATCGGTATGTGCTAACTGCTGCCCATTGTGTGGCCCAGGCGGC
GACTAGCAATCTGCAGATTACTGCTGTCCGGTTGGGTGAATGGGACACTA
GCACGAATCCCGACTGTCAGTACCATGAGGATAGTAAAGTGGCGGATTGC
GCGCCTCCCTACCAGGACATAGCCATCGAGGAGTTGCTTCCACATCCGCT
CTACAATCGCACCGACAGGACGCAGATCAACGACATTGCCCTCGTCCGAC
TGGCAAGTCCTGCCAAGCTCAACGACTTTGTGCAACCCATTTGCCTGCCC
AACAAGCAGCTGCGAGCGGACGAGCTGGAGGACCTGGTCACCGAGGTGGC
CGGATGGCAGGCTAGTTCCTCGCAAAGGATGCGAAAAGGTTATGTGACCA
TTAGTTCGATTGAGGAGTGTCAAAGGAAGTACGCCAGCCAGCAGTTGCGC
ATCCAAGCCTCGAAGCTCTGTGGCCTGACCAATTCCCAGGAGTGCTACGG
CAACGCTGGTGGACCACTGATGCTGTTCAAGAACGATGGCTATCTGCTCG
GTGGACTGGTGTCGTTCGGACCCGTTCCCTGCCCCAATCCCGACTGGCCG
GATGTCTACACCAGGGTGGCGTCCTACATCGATTGGATTCACGACAGTCT
CAAAGCATAGATTGAAGTAAATACTTGGTACAACAAAATGTTCAGTAAAA
CAAACTAAAATAAAAAAAAAAAAAAAAAA

LP10895.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3505.a 1339 CG3505.a 167..1329 1..1163 5815 100 Plus
CG3505.b 1919 CG3505.b 747..1909 1..1163 5815 100 Plus
CG3505-RA 1378 CG3505-RA 167..1329 1..1163 5815 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10483231..10483980 412..1161 3750 100 Plus
chr3R 27901430 chr3R 10482395..10482576 85..266 910 100 Plus
chr3R 27901430 chr3R 10483010..10483160 263..413 755 100 Plus
chr3R 27901430 chr3R 10482223..10482307 1..85 425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14658479..14659230 412..1163 3760 100 Plus
3R 32079331 3R 14657643..14657824 85..266 910 100 Plus
3R 32079331 3R 14658258..14658408 263..413 755 100 Plus
3R 32079331 3R 14657471..14657555 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14399310..14400061 412..1163 3760 100 Plus
3R 31820162 3R 14398474..14398655 85..266 910 100 Plus
3R 31820162 3R 14399089..14399239 263..413 755 100 Plus
3R 31820162 3R 14398302..14398386 1..85 425 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:17 has no hits.

LP10895.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:20 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10482223..10482307 1..85 100 -> Plus
chr3R 10482396..10482574 86..264 100 -> Plus
chr3R 10483012..10483159 265..412 100 -> Plus
chr3R 10483232..10483980 413..1161 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:56 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1083 28..1110 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:27:39 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1083 28..1110 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:04 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1083 28..1110 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:02:27 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1083 28..1110 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:54 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1083 28..1110 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:54:14 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:27:39 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 15..1175 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:04 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 15..1175 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:02:27 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:54 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
CG3505-RA 25..1185 1..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:20 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14657471..14657555 1..85 100 -> Plus
3R 14657644..14657822 86..264 100 -> Plus
3R 14658260..14658407 265..412 100 -> Plus
3R 14658480..14659228 413..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:20 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14657471..14657555 1..85 100 -> Plus
3R 14657644..14657822 86..264 100 -> Plus
3R 14658260..14658407 265..412 100 -> Plus
3R 14658480..14659228 413..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:20 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14657471..14657555 1..85 100 -> Plus
3R 14657644..14657822 86..264 100 -> Plus
3R 14658260..14658407 265..412 100 -> Plus
3R 14658480..14659228 413..1161 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:04 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10483193..10483277 1..85 100 -> Plus
arm_3R 10483366..10483544 86..264 100 -> Plus
arm_3R 10483982..10484129 265..412 100 -> Plus
arm_3R 10484202..10484950 413..1161 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:35:44 Download gff for LP10895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14399311..14400059 413..1161 100   Plus
3R 14398302..14398386 1..85 100 -> Plus
3R 14398475..14398653 86..264 100 -> Plus
3R 14399091..14399238 265..412 100 -> Plus

LP10895.pep Sequence

Translation from 27 to 1109

> LP10895.pep
MGSFPALLVVVGSLALGANAQLPPINCVAKIPSGRVTGHCISIRECDYFM
RILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDC
GKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTA
AHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAI
EELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADEL
EDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGL
TNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASY
IDWIHDSLKA*

LP10895.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17450-PA 360 GF17450-PA 1..360 1..360 1471 74.4 Plus
Dana\GF23198-PA 392 GF23198-PA 1..392 1..360 683 38.7 Plus
Dana\GF18202-PA 393 GF18202-PA 37..392 38..359 641 41.2 Plus
Dana\GF16252-PA 399 GF16252-PA 37..399 34..360 525 35.4 Plus
Dana\GF17682-PA 394 GF17682-PA 41..393 38..359 458 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16868-PA 360 GG16868-PA 1..360 1..360 1790 92.2 Plus
Dere\GG16913-PA 392 GG16913-PA 9..392 9..360 654 37.9 Plus
Dere\GG12275-PA 392 GG12275-PA 36..392 37..360 618 37.7 Plus
Dere\GG11216-PA 400 GG11216-PA 43..399 37..359 500 34.5 Plus
Dere\GG11217-PA 407 GG11217-PA 8..407 4..360 497 33 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18659-PA 371 GH18659-PA 12..371 9..360 1066 56.5 Plus
Dgri\GH14281-PA 578 GH14281-PA 224..577 31..359 642 39.2 Plus
Dgri\GH17456-PA 395 GH17456-PA 26..395 30..360 580 37.5 Plus
Dgri\GH17229-PA 387 GH17229-PA 29..387 34..360 562 36.8 Plus
Dgri\GH19111-PA 344 GH19111-PA 6..343 57..359 505 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3505-PA 360 CG3505-PA 1..360 1..360 1924 100 Plus
ea-PA 392 CG4920-PA 7..392 7..360 656 38 Plus
MP1-PA 390 CG1102-PA 36..390 37..360 632 38.3 Plus
MP1-PE 400 CG1102-PE 36..400 37..360 619 37.5 Plus
MP1-PC 399 CG1102-PC 36..399 37..360 613 37.6 Plus
ea-PB 261 CG4920-PB 3..261 113..360 583 44.6 Plus
SPE-PA 400 CG16705-PA 12..399 13..359 498 33.2 Plus
Sp7-PF 391 CG3066-PF 39..390 38..359 487 35.5 Plus
Sp7-PE 391 CG3066-PE 39..390 38..359 487 35.5 Plus
Sp7-PA 391 CG3066-PA 39..390 38..359 487 35.5 Plus
CG9733-PB 417 CG9733-PB 149..417 97..360 414 35.4 Plus
CG9733-PA 418 CG9733-PA 150..418 97..360 414 35.4 Plus
CG31220-PB 363 CG31220-PB 33..362 40..359 411 34.5 Plus
Ser7-PA 397 CG2045-PA 6..394 5..360 399 30.1 Plus
CG11313-PC 367 CG11313-PC 31..366 37..359 393 34.7 Plus
CG10232-PD 509 CG10232-PD 194..508 40..359 386 30.7 Plus
CG9737-PA 424 CG9737-PA 30..406 31..354 385 30.1 Plus
CG11313-PD 370 CG11313-PD 31..369 37..359 382 34.4 Plus
CG16710-PB 372 CG16710-PB 23..362 18..354 356 28.5 Plus
CG8870-PA 356 CG8870-PA 32..343 40..360 351 30.9 Plus
CG5909-PA 381 CG5909-PA 26..381 31..359 349 28.7 Plus
CG31219-PB 345 CG31219-PB 64..344 79..359 331 30.5 Plus
grass-PA 335 CG5896-PA 68..330 99..358 324 32.9 Plus
grass-PB 377 CG5896-PB 110..372 99..358 324 32.9 Plus
CG12133-PB 340 CG12133-PB 1..317 50..354 322 30.2 Plus
CG1299-PB 442 CG1299-PB 103..434 38..354 302 28.7 Plus
CG1299-PA 511 CG1299-PA 172..503 38..354 302 28.7 Plus
CG18754-PB 341 CG18754-PB 36..339 40..358 299 27.8 Plus
CG17572-PA 385 CG17572-PA 101..381 71..357 296 31.6 Plus
CG32260-PC 395 CG32260-PC 153..388 112..354 292 34.1 Plus
CG32260-PA 575 CG32260-PA 333..568 112..354 292 34.1 Plus
CG30088-PB 281 CG30088-PB 50..272 112..354 287 33.7 Plus
CG18754-PC 296 CG18754-PC 1..294 50..358 287 28 Plus
CG30286-PB 277 CG30286-PB 18..272 92..358 284 33 Plus
CG8172-PD 371 CG8172-PD 110..363 94..355 284 33.1 Plus
CG8172-PE 545 CG8172-PE 290..537 100..355 280 33.5 Plus
CG8172-PF 561 CG8172-PF 306..553 100..355 280 33.5 Plus
CG11836-PI 281 CG11836-PI 51..275 113..359 276 31.6 Plus
CG11836-PJ 333 CG11836-PJ 103..327 113..359 276 31.6 Plus
CG7432-PB 721 CG7432-PB 462..717 97..356 275 32.1 Plus
l(2)k05911-PC 639 CG31728-PC 410..639 117..359 270 29.9 Plus
CG4914-PA 374 CG4914-PA 132..360 111..354 265 29.8 Plus
CG30087-PA 277 CG30087-PA 44..274 109..358 261 31.2 Plus
Hayan-PA 378 CG6361-PA 14..368 7..354 258 28.1 Plus
CG30414-PC 305 CG30414-PC 13..295 82..359 256 28.1 Plus
CG30414-PB 305 CG30414-PB 13..295 82..359 256 28.1 Plus
CG11836-PF 223 CG11836-PF 9..217 133..359 251 31.8 Plus
CG11836-PE 223 CG11836-PE 9..217 133..359 251 31.8 Plus
CG11836-PG 223 CG11836-PG 9..217 133..359 251 31.8 Plus
CG11836-PC 223 CG11836-PC 9..217 133..359 251 31.8 Plus
CG11836-PA 223 CG11836-PA 9..217 133..359 251 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10684-PA 372 GI10684-PA 1..372 1..360 1187 60.3 Plus
Dmoj\GI24877-PA 392 GI24877-PA 6..391 6..359 670 38.2 Plus
Dmoj\GI22780-PA 412 GI22780-PA 1..411 1..359 572 34.6 Plus
Dmoj\GI24127-PA 389 GI24127-PA 2..389 4..360 538 35.2 Plus
Dmoj\GI10853-PA 285 GI10853-PA 28..285 112..360 514 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24416-PA 370 GL24416-PA 1..370 1..360 1368 70.4 Plus
Dper\GL23240-PA 395 GL23240-PA 40..394 31..359 622 38.2 Plus
Dper\GL12316-PA 391 GL12316-PA 36..390 37..359 585 37.1 Plus
Dper\GL13652-PA 401 GL13652-PA 30..401 20..360 544 35.5 Plus
Dper\GL12453-PA 383 GL12453-PA 4..382 3..359 503 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17488-PB 370 GA17488-PB 1..370 1..360 1411 69.8 Plus
Dpse\GA18526-PA 395 GA18526-PA 40..394 31..359 624 38.2 Plus
Dpse\GA10711-PA 391 GA10711-PA 36..390 37..359 582 37.1 Plus
Dpse\GA14092-PA 403 GA14092-PA 32..403 20..360 545 35.5 Plus
Dpse\GA15903-PA 383 GA15903-PA 4..382 3..359 499 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24177-PA 360 GM24177-PA 1..360 1..360 1870 96.4 Plus
Dsec\GM24220-PA 402 GM24220-PA 48..402 31..360 649 39 Plus
Dsec\GM26516-PA 400 GM26516-PA 43..399 37..359 513 35.5 Plus
Dsec\GM10972-PA 391 GM10972-PA 39..390 38..359 481 34.4 Plus
Dsec\GM26518-PA 406 GM26518-PA 7..406 3..360 477 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18970-PA 360 GD18970-PA 1..360 1..360 1867 96.4 Plus
Dsim\GD19011-PA 392 GD19011-PA 7..392 7..360 660 37.7 Plus
Dsim\GD19715-PA 392 GD19715-PA 36..392 37..360 616 38.3 Plus
Dsim\GD21025-PA 400 GD21025-PA 44..399 38..359 512 35.3 Plus
Dsim\GD19946-PA 391 GD19946-PA 39..390 38..359 480 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24354-PA 326 GJ24354-PA 1..326 50..360 1114 63.8 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 523..876 31..359 660 40 Plus
Dvir\GJ14460-PA 396 GJ14460-PA 32..396 37..360 596 36.9 Plus
Dvir\GJ22783-PA 401 GJ22783-PA 38..400 38..359 547 36.9 Plus
Dvir\GJ10951-PA 386 GJ10951-PA 35..386 38..360 478 34.2 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 246..505 117..359 263 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12812-PA 360 GK12812-PA 10..360 9..360 1270 65.5 Plus
Dwil\GK11130-PA 392 GK11130-PA 1..392 1..360 647 36.9 Plus
Dwil\GK10951-PA 391 GK10951-PA 1..390 4..359 637 38.5 Plus
Dwil\GK13188-PA 395 GK13188-PA 30..395 26..360 513 36.3 Plus
Dwil\GK12018-PA 384 GK12018-PA 30..383 31..359 491 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24249-PA 360 GE24249-PA 1..360 1..360 1812 93.3 Plus
Dyak\GE24296-PA 392 GE24296-PA 38..392 31..360 662 40.2 Plus
Dyak\GE25404-PA 376 GE25404-PA 36..376 37..360 599 39.7 Plus
Dyak\GE10382-PA 400 GE10382-PA 43..399 37..359 508 35.2 Plus
Dyak\GE10383-PA 404 GE10383-PA 13..404 14..360 504 33.3 Plus

LP10895.hyp Sequence

Translation from 27 to 1109

> LP10895.hyp
MGSFPALLVVVGSLALGANAQLPPINCVAKIPSGRVTGHCISIRECDYFM
RILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDC
GKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTA
AHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAI
EELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADEL
EDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGL
TNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASY
IDWIHDSLKA*

LP10895.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3505-PA 360 CG3505-PA 1..360 1..360 1924 100 Plus
ea-PA 392 CG4920-PA 7..392 7..360 656 38 Plus
MP1-PA 390 CG1102-PA 36..390 37..360 632 38.3 Plus
MP1-PC 399 CG1102-PC 36..399 37..360 613 37.6 Plus
ea-PB 261 CG4920-PB 3..261 113..360 583 44.6 Plus