Clone LP10960 Report

Search the DGRC for LP10960

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:109
Well:60
Vector:pOT2
Associated Gene/TranscriptAg5r2-RA
Protein status:LP10960.pep: gold
Preliminary Size:849
Sequenced Size:866

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9540 2002-01-01 Sim4 clustering to Release 2
CG9540 2002-06-04 Blastp of sequenced clone
CG9540 2003-01-01 Sim4 clustering to Release 3
Ag5r2 2008-04-29 Release 5.5 accounting
Ag5r2 2008-08-15 Release 5.9 accounting
Ag5r2 2008-12-18 5.12 accounting

Clone Sequence Records

LP10960.complete Sequence

866 bp (866 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118616

> LP10960.complete
TTAATCGCAACAAAGGCAATATGAAACTCGCTCTGCTTGCCATCCTGATC
GTTTCCTTGGCCCTGGCCCAGGCCACCGACTATTGTTCGTCGGACATCTG
CAACGGTGGCTCCCACATCGCCTGTGGGCATAGCAACTGGTGGGACAGTA
GCTGTCCCGGCGATGCCGAGCTGATCGACATCAACGATGACTACAAGTGG
GTCTTTGTCCACTCGCACAACGACAAGAGGAACTACATTGCCGGTGGCTA
CGATTCCAATCACAATGCCGCCTGCCGTATGGCCACCATGGAGTGGGACG
ATGAGCTGGCCTATCTGGCCTCCCTGAATGTGCGCCAGTGCAACATGGTG
CACGATAGCTGCCACAACACCGACGCCTTCAAGTACTCCGGCCAGAATCT
GGCATGGCAGGCCTACTCCGGCGACCTGCCCGACATGGGCTACATCCTGG
ACAACAGCGTGCAGATGTGGTTCGATGAGGTGCACAACTCCAACGCCGGT
ATTATTGCCGGCGGATACCCATCCGGATATAACGGACCTGCCATTGGCCA
CTTCACCGTGATGATGTCGGAGAGGAACACCCGCTTGGGATGTGCTGCTG
CTCGGTACAATCGCGATGGATGGAACCAAGTGCTGGTGGCCTGCAACTAT
GCTACCACCAATATGATCGGACGCCAGATCTACTCCAGCTGTGACTGGGG
AGCACAGGGCTGCGGATCGGGCACCAATGGCGAGTTTGGTAACCTCTGCT
CAACATCCGAGTGGTACGACGTGAACAGCTGGTAAATCTAGCAAATTCAA
AGTGCACAATTAAAAGCTATTTCAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

LP10960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r2-RA 1047 Ag5r2-RA 117..943 1..827 4135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14673786..14674323 538..1 2690 100 Minus
chrX 22417052 chrX 14673259..14673543 823..539 1410 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14783489..14784026 538..1 2690 100 Minus
X 23542271 X 14782958..14783246 827..539 1445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14791587..14792124 538..1 2690 100 Minus
X 23527363 X 14791056..14791344 827..539 1445 100 Minus
X 23527363 X 14784415..14784449 573..539 145 94.2 Minus
Blast to na_te.dros performed on 2019-03-16 02:56:48 has no hits.

LP10960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:57:51 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14673259..14673543 539..823 99 <- Minus
chrX 14673786..14674323 1..538 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:03 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:29 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:18 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:50 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:57 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:57 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 17..839 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:29 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 17..839 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:18 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 27..849 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:50 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 17..839 1..823 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:57 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
Ag5r2-RA 27..849 1..823 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:51 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
X 14782962..14783246 539..823 100 <- Minus
X 14783489..14784026 1..538 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:51 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
X 14782962..14783246 539..823 100 <- Minus
X 14783489..14784026 1..538 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:51 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
X 14782962..14783246 539..823 100 <- Minus
X 14783489..14784026 1..538 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:18 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14676995..14677279 539..823 100 <- Minus
arm_X 14677522..14678059 1..538 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:29 Download gff for LP10960.complete
Subject Subject Range Query Range Percent Splice Strand
X 14791060..14791344 539..823 100 <- Minus
X 14791587..14792124 1..538 100   Minus

LP10960.hyp Sequence

Translation from 2 to 784

> LP10960.hyp
NRNKGNMKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSS
CPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDD
ELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILD
NSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAA
RYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCS
TSEWYDVNSW*

LP10960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r2-PA 254 CG9540-PA 1..254 7..260 1425 100 Plus
Ag5r-PC 256 CG9538-PC 10..253 15..259 637 50.4 Plus
Ag5r-PB 256 CG9538-PB 10..253 15..259 637 50.4 Plus
Ag5r-PA 256 CG9538-PA 10..253 15..259 637 50.4 Plus
CG32679-PA 254 CG32679-PA 10..252 11..260 465 38.2 Plus

LP10960.pep Sequence

Translation from 20 to 784

> LP10960.pep
MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAE
LIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLA
SLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMW
FDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYNRDG
WNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYD
VNSW*

LP10960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21598-PA 255 GF21598-PA 1..255 1..254 1251 91 Plus
Dana\GF19647-PA 218 GF19647-PA 2..214 41..252 534 51.9 Plus
Dana\GF21595-PA 256 GF21595-PA 9..256 5..251 513 45.1 Plus
Dana\GF21134-PA 248 GF21134-PA 7..247 5..243 469 40 Plus
Dana\GF20496-PA 256 GF20496-PA 13..255 5..254 462 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19450-PA 288 GG19450-PA 35..288 1..254 1304 95.3 Plus
Dere\GG19449-PA 256 GG19449-PA 4..252 3..252 621 50.6 Plus
Dere\GG18928-PA 253 GG18928-PA 5..251 1..254 456 38.4 Plus
Dere\GG18056-PA 264 GG18056-PA 7..253 1..250 423 34.3 Plus
Dere\GG17230-PA 262 GG17230-PA 18..251 18..250 411 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12214-PA 256 GH12214-PA 7..252 6..252 595 48.6 Plus
Dgri\GH24697-PA 274 GH24697-PA 17..270 1..252 534 43.9 Plus
Dgri\GH12213-PA 256 GH12213-PA 1..256 1..251 494 41.9 Plus
Dgri\GH12878-PA 260 GH12878-PA 27..258 18..254 448 41.4 Plus
Dgri\GH17451-PA 253 GH17451-PA 1..253 5..251 437 37.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ag5r2-PA 254 CG9540-PA 1..254 1..254 1425 100 Plus
Ag5r-PC 256 CG9538-PC 10..253 9..253 637 50.4 Plus
Ag5r-PB 256 CG9538-PB 10..253 9..253 637 50.4 Plus
Ag5r-PA 256 CG9538-PA 10..253 9..253 637 50.4 Plus
CG32679-PA 254 CG32679-PA 10..252 5..254 465 38.2 Plus
scpr-A-PA 264 CG5207-PA 7..253 5..250 414 34.8 Plus
scpr-B-PA 262 CG17210-PA 1..251 1..250 411 34.6 Plus
scpr-C-PB 262 CG5106-PB 1..251 1..250 409 34.6 Plus
scpr-C-PA 262 CG5106-PA 1..251 1..250 409 34.6 Plus
CG9822-PA 263 CG9822-PA 13..259 8..252 378 34.7 Plus
CG42780-PA 253 CG42780-PA 1..251 1..244 369 34.6 Plus
CG17974-PA 259 CG17974-PA 5..258 3..252 368 35.1 Plus
CG42780-PB 254 CG42780-PB 1..252 1..244 363 34.9 Plus
CG6628-PA 277 CG6628-PA 24..260 14..249 341 37 Plus
CG42564-PA 500 CG10284-PA 54..284 20..250 341 31.9 Plus
CG9400-PA 308 CG9400-PA 39..288 10..253 326 29.1 Plus
CG3640-PA 296 CG3640-PA 11..254 6..253 325 31.6 Plus
CG17575-PA 291 CG17575-PA 9..283 5..250 311 31.4 Plus
CG17575-PB 298 CG17575-PB 9..290 5..250 297 30.5 Plus
CG34002-PB 350 CG34002-PB 22..255 15..247 291 28.7 Plus
CG30486-PA 263 CG30486-PA 2..256 3..253 278 29.7 Plus
CG10651-PB 316 CG10651-PB 23..251 21..247 233 28.3 Plus
CG10651-PA 316 CG10651-PA 23..251 21..247 233 28.3 Plus
antr-PB 272 CG30488-PB 6..255 3..253 208 24.5 Plus
CG31296-PB 280 CG31296-PB 15..254 11..252 204 25.5 Plus
CG31296-PA 280 CG31296-PA 15..254 11..252 204 25.5 Plus
CG8072-PA 247 CG8072-PA 4..242 1..245 198 25.2 Plus
antr-PA 265 CG30488-PA 6..248 3..253 193 24.2 Plus
CG11977-PB 274 CG11977-PB 43..214 20..195 151 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15745-PA 257 GI15745-PA 2..252 1..252 599 46.9 Plus
Dmoj\GI15747-PA 256 GI15747-PA 4..252 5..252 572 47.2 Plus
Dmoj\GI15744-PA 256 GI15744-PA 1..256 1..251 534 44.4 Plus
Dmoj\Tes104-PA 260 GI22692-PA 1..249 3..250 444 36.2 Plus
Dmoj\GI23890-PA 260 GI23890-PA 1..249 1..250 423 35.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20410-PA 254 GL20410-PA 1..254 1..254 1170 87.8 Plus
Dper\GL20409-PA 257 GL20409-PA 4..253 5..252 605 50.2 Plus
Dper\GL14627-PA 248 GL14627-PA 3..233 1..231 422 37.6 Plus
Dper\GL12032-PA 261 GL12032-PA 18..250 19..250 422 36.9 Plus
Dper\GL12570-PA 261 GL12570-PA 18..250 19..250 420 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21866-PA 254 GA21866-PA 1..254 1..254 1170 87.8 Plus
Dpse\GA21864-PA 257 GA21864-PA 4..253 5..252 597 49.8 Plus
Dpse\GA29233-PA 258 GA29233-PA 6..258 3..251 515 43.1 Plus
Dpse\GA23354-PA 263 GA23354-PA 19..261 5..254 461 41.7 Plus
Dpse\GA28431-PA 253 GA28431-PA 3..249 1..247 455 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12040-PA 254 GM12040-PA 1..254 1..254 1301 95.7 Plus
Dsec\GM12039-PA 256 GM12039-PA 4..252 3..252 607 49.8 Plus
Dsec\GM11319-PA 237 GM11319-PA 8..235 20..254 434 39.4 Plus
Dsec\GM23927-PA 262 GM23927-PA 18..251 18..250 412 35.4 Plus
Dsec\GM26110-PA 262 GM26110-PA 18..251 18..250 412 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23705-PA 168 GD23705-PA 1..168 87..254 855 94 Plus
Dsim\GD16039-PA 254 GD16039-PA 8..252 3..254 462 38.3 Plus
Dsim\GD18744-PA 277 GD18744-PA 6..253 4..250 420 34.3 Plus
Dsim\GD20669-PA 262 GD20669-PA 18..251 18..250 410 35 Plus
Dsim\GD25203-PA 263 GD25203-PA 13..259 8..252 368 34.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18606-PA 256 GJ18606-PA 5..252 3..252 621 50.4 Plus
Dvir\GJ14736-PA 270 GJ14736-PA 13..264 1..252 555 47 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 2..253 1..251 546 43.9 Plus
Dvir\GJ10116-PA 253 GJ10116-PA 2..253 1..251 485 40.6 Plus
Dvir\GJ18491-PA 324 GJ18491-PA 86..322 15..254 430 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14719-PA 256 GK14719-PA 19..256 17..254 1214 94.1 Plus
Dwil\GK18446-PA 263 GK18446-PA 12..259 5..252 579 48.8 Plus
Dwil\GK18435-PA 257 GK18435-PA 22..257 17..251 538 46 Plus
Dwil\GK14730-PA 256 GK14730-PA 17..256 15..251 503 44.2 Plus
Dwil\GK14741-PA 240 GK14741-PA 1..240 15..251 499 42.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16103-PA 283 GE16103-PA 30..283 1..254 1314 96.5 Plus
Dyak\Ag5r-PA 256 GE16102-PA 4..252 3..252 611 49.6 Plus
Dyak\GE15398-PA 253 GE15398-PA 12..251 8..254 458 39.1 Plus
Dyak\GE26087-PA 264 GE26087-PA 6..253 4..250 438 35.1 Plus
Dyak\GE24631-PA 262 GE24631-PA 18..251 18..250 412 35.4 Plus