Clone LP10995 Report

Search the DGRC for LP10995

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:109
Well:95
Vector:pOT2
Associated Gene/TranscriptMst98Cb-RA
Protein status:LP10995.pep: gold
Preliminary Size:1052
Sequenced Size:1066

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18396 2002-01-01 Sim4 clustering to Release 2
CG18396 2002-06-04 Blastp of sequenced clone
CG18396 2003-01-01 Sim4 clustering to Release 3
Mst98Cb 2008-04-29 Release 5.5 accounting
Mst98Cb 2008-08-15 Release 5.9 accounting
Mst98Cb 2008-12-18 5.12 accounting

Clone Sequence Records

LP10995.complete Sequence

1066 bp (1066 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118617

> LP10995.complete
CTTCGATACACTTCTAAATTTCTCTGATCAAATTTTATAAGAAACAAAAA
ACAAAAATTAACTTTTTACTCTTTCGGTTTATTCTAGTCGAAACTTAAAA
TGTGCTCTCCGTGCGGTCCTTGTAGTCCATGCGATCCCTGCTGCGGTCCC
TTCGAGTGCTCACCCAAGTGCTACAATGCCGCCCAATTGGAGGCCTTGCC
ACAATGTGCTCCACGTATTCCACCACCCTTCCCCAAATGCATCACCGTGC
AGCAACCACCACGCATGATCTGCAAGAAACGCGTTGTGTTCACGGAGAAG
ATTGTGCCGGAGCCAATGGTGGTTAACCGATGCAGGCAGATCACCATTCC
AAAGGTCGTTGATGCCACGCGGGTGATCAAGGTGCCCAAGCTGATTTGGG
TGTCGCAGATGGTGCGAGAACCCAGAGTAATCTACTACCCCTCGATGATC
CCCGACCCCTATGTGGTGTGCTATCCCAAGCGCGTCTGCGAACCACGTGA
GGTGTGTCAGTCGATCCTCTGCCAGCCGAAGCCCCAAACCATCGACATTC
CGCCGCCGAGGGAGTACTGCTGCTATCCAAATGGACCCATCAACTACAAG
CCCAGTGCAGCGTGCCCACCCTGCCCCATTGGACCATGTGCTCCTGGAGG
ACCCTGCTGTCCGCTGCCCTGCTTCTCCACAAACCAATACCCAGTGGCTG
AGGGCAGATGCGGACCATGTGGACCCTGTGGACCCGGATGCGGACCTTGC
GGACCCTGCGGACCTTGGGGACCAGGATGCGGTCCTTGCGGACCCTGTGG
ACCCTGCGGACCCTTCGGACCAGGCTGTGGTCCATGCGGACCGTGTGGAC
CCTGCGGACCTGGCCCTTGTGGCTTCGGTCCTTGCGGACCATGCTGATCT
GTAAAACAGCTGGAAAGATCTACTTGACGTCTGCCAAAAACATTTTGTGA
CAACTCCGCGTTATGGAAGTCCACATCCGCGCTCAATTATATGACAGTCC
AAATTAACTTTGCAAGTTTTGTAAATTAAAGAAGTGCATTGATACAATAA
AAAAAAAAAAAAAAAA

LP10995.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Mst98Cb-RA 1065 Mst98Cb-RA 14..1062 1..1049 5245 100 Plus
Mst98Ca-RA 1331 Mst98Ca-RA 127..779 100..752 2890 96.1 Plus
Mst98Ca-RA 1331 Mst98Ca-RA 736..804 748..813 155 84 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24115748..24116795 1..1048 5240 100 Plus
chr3R 27901430 chr3R 24114391..24115043 100..752 2890 96.2 Plus
chr3R 27901430 chr3R 24116486..24116559 787..860 235 87.8 Plus
chr3R 27901430 chr3R 24116534..24116607 739..812 235 87.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28292816..28293864 1..1049 5245 100 Plus
3R 32079331 3R 28291459..28292111 100..752 2890 96.2 Plus
3R 32079331 3R 28293554..28293627 787..860 235 87.8 Plus
3R 32079331 3R 28293602..28293675 739..812 235 87.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28033647..28034695 1..1049 5245 100 Plus
3R 31820162 3R 28032290..28032942 100..752 2890 96.1 Plus
3R 31820162 3R 28032899..28032967 748..813 155 84 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:22 has no hits.

LP10995.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:23 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24115748..24116455 1..708 100 == Plus
chr3R 24116608..24116795 861..1048 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:06 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 1..798 100..897 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:30 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 1..798 100..897 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:11 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 1..798 100..897 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:55 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 1..798 100..897 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:59 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 1..798 100..897 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:58 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 14..1061 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:30 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 19..1066 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:11 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 19..1066 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:55 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 14..1061 1..1048 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:59 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
Mst98Cb-RA 19..1066 1..1048 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:23 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28292816..28293863 1..1048 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:23 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28292816..28293863 1..1048 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:23 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28292816..28293863 1..1048 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:11 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24118538..24119585 1..1048 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:30 Download gff for LP10995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28033647..28034694 1..1048 100   Plus

LP10995.hyp Sequence

Translation from 99 to 896

> LP10995.hyp
MCSPCGPCSPCDPCCGPFECSPKCYNAAQLEALPQCAPRIPPPFPKCITV
QQPPRMICKKRVVFTEKIVPEPMVVNRCRQITIPKVVDATRVIKVPKLIW
VSQMVREPRVIYYPSMIPDPYVVCYPKRVCEPREVCQSILCQPKPQTIDI
PPPREYCCYPNGPINYKPSAACPPCPIGPCAPGGPCCPLPCFSTNQYPVA
EGRCGPCGPCGPGCGPCGPCGPWGPGCGPCGPCGPCGPFGPGCGPCGPCG
PCGPGPCGFGPCGPC*

LP10995.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Mst98Cb-PA 265 CG18396-PA 1..265 1..265 1629 100 Plus
Mst98Ca-PA 334 CG11719-PA 1..290 1..265 1479 89.3 Plus
Mst84Db-PA 74 CG17934-PA 7..68 202..265 274 64.8 Plus
Mst84Dd-PA 72 CG17935-PA 3..56 180..252 255 63.5 Plus
Mst84Db-PA 74 CG17934-PA 2..73 157..250 244 50.5 Plus
Mst84Dd-PA 72 CG17935-PA 3..56 207..265 231 71 Plus
Mst84Db-PA 74 CG17934-PA 3..61 207..265 210 56.5 Plus
Mst87F-PB 56 CG17956-PB 3..55 204..262 207 62.9 Plus
Mst84Dd-PA 72 CG17935-PA 3..55 158..222 167 51.5 Plus
Mst84Dd-PA 72 CG17935-PA 2..53 226..265 164 67.3 Plus

LP10995.pep Sequence

Translation from 99 to 896

> LP10995.pep
MCSPCGPCSPCDPCCGPFECSPKCYNAAQLEALPQCAPRIPPPFPKCITV
QQPPRMICKKRVVFTEKIVPEPMVVNRCRQITIPKVVDATRVIKVPKLIW
VSQMVREPRVIYYPSMIPDPYVVCYPKRVCEPREVCQSILCQPKPQTIDI
PPPREYCCYPNGPINYKPSAACPPCPIGPCAPGGPCCPLPCFSTNQYPVA
EGRCGPCGPCGPGCGPCGPCGPWGPGCGPCGPCGPCGPFGPGCGPCGPCG
PCGPGPCGFGPCGPC*

LP10995.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18879-PA 288 GF18879-PA 1..288 1..265 1128 89.6 Plus
Dana\GF18878-PA 341 GF18878-PA 1..340 1..254 984 70.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11593-PA 265 GG11593-PA 1..265 1..265 1244 99.2 Plus
Dere\GG11592-PA 337 GG11592-PA 1..337 1..265 992 72.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23911-PA 339 GH23911-PA 1..339 1..265 975 68.9 Plus
Dgri\GH20298-PA 259 GH20298-PA 1..203 1..203 962 97.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Mst98Cb-PA 265 CG18396-PA 1..265 1..265 1629 100 Plus
Mst98Ca-PA 334 CG11719-PA 1..290 1..265 1479 89.3 Plus
Mst84Db-PA 74 CG17934-PA 7..68 202..265 274 64.8 Plus
Mst84Dd-PA 72 CG17935-PA 3..56 180..252 255 63.5 Plus
Mst84Db-PA 74 CG17934-PA 2..73 157..250 244 50.5 Plus
Mst84Dd-PA 72 CG17935-PA 3..56 207..265 231 71 Plus
Mst84Db-PA 74 CG17934-PA 3..61 207..265 210 56.5 Plus
Mst87F-PB 56 CG17956-PB 3..55 204..262 207 62.9 Plus
Mst87F-PA 56 CG17956-PA 3..55 204..262 207 62.9 Plus
Mur82C-PB 578 CG12586-PB 401..476 173..264 205 55.4 Plus
Mst84Da-PA 63 CG17946-PA 14..62 211..265 201 63.6 Plus
Mur82C-PB 578 CG12586-PB 410..477 173..255 190 55.4 Plus
Mst84Da-PA 63 CG17946-PA 13..62 183..249 189 55.9 Plus
lcs-PA 145 CG12794-PA 16..97 169..258 184 53.8 Plus
Mst84Dc-PB 55 CG17945-PB 3..53 207..265 183 60.9 Plus
Mst84Dc-PA 55 CG17945-PA 3..53 207..265 183 60.9 Plus
CG9130-PB 517 CG9130-PB 225..316 176..265 174 41.6 Plus
CG9130-PA 517 CG9130-PA 225..316 176..265 174 41.6 Plus
frm-PD 268 CG10625-PD 132..244 160..264 170 44.8 Plus
frm-PA 268 CG10625-PA 132..244 160..264 170 44.8 Plus
frm-PE 652 CG10625-PE 516..628 160..264 170 44.8 Plus
frm-PB 682 CG10625-PB 546..658 160..264 170 44.8 Plus
frm-PC 682 CG10625-PC 546..658 160..264 170 44.8 Plus
frm-PJ 752 CG10625-PJ 132..244 160..264 170 44.8 Plus
frm-PI 766 CG10625-PI 132..244 160..264 170 44.8 Plus
frm-PH 1180 CG10625-PH 546..658 160..264 170 44.8 Plus
Mst84Dd-PA 72 CG17935-PA 3..55 158..222 167 51.5 Plus
Mst84Dd-PA 72 CG17935-PA 2..53 226..265 164 67.3 Plus
Mur82C-PB 578 CG12586-PB 396..461 202..264 164 60.9 Plus
frm-PD 268 CG10625-PD 115..187 177..264 160 48.9 Plus
frm-PA 268 CG10625-PA 115..187 177..264 160 48.9 Plus
frm-PE 652 CG10625-PE 499..571 177..264 160 48.9 Plus
frm-PB 682 CG10625-PB 529..601 177..264 160 48.9 Plus
frm-PC 682 CG10625-PC 529..601 177..264 160 48.9 Plus
frm-PJ 752 CG10625-PJ 115..187 177..264 160 48.9 Plus
frm-PI 766 CG10625-PI 115..187 177..264 160 48.9 Plus
frm-PH 1180 CG10625-PH 529..601 177..264 160 48.9 Plus
Pif2-PA 118 CG31483-PA 17..112 157..265 159 42.3 Plus
Pif2-PA 118 CG31483-PA 2..84 172..265 158 44.3 Plus
Mst84Dc-PB 55 CG17945-PB 3..53 180..246 156 47.1 Plus
Mst84Dc-PA 55 CG17945-PA 3..53 180..246 156 47.1 Plus
Mur82C-PB 578 CG12586-PB 407..478 160..243 151 50.6 Plus
CG31740-PA 61 CG31740-PA 15..61 208..259 150 55.8 Plus
Mst87F-PB 56 CG17956-PB 3..55 172..246 149 49.4 Plus
Mst87F-PA 56 CG17956-PA 3..55 172..246 149 49.4 Plus
CG31639-PB 58 CG31639-PB 2..58 207..257 146 57.6 Plus
CG31639-PA 58 CG31639-PA 2..58 207..257 146 57.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21836-PA 327 GI21836-PA 1..327 1..265 1011 73.4 Plus
Dmoj\GI10867-PA 320 GI10867-PA 1..320 1..265 1002 76.6 Plus
Dmoj\GI19968-PA 275 GI19968-PA 1..203 1..203 964 98 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23653-PA 270 GL23653-PA 1..270 1..265 1158 94.8 Plus
Dper\GL23652-PA 343 GL23652-PA 1..210 1..209 929 98.1 Plus
Dper\GL25610-PA 227 GL25610-PA 1..159 1..169 630 83.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14917-PA 264 GA14917-PA 1..264 1..265 1168 96.6 Plus
Dpse\GA26684-PA 343 GA26684-PA 1..287 1..260 933 82.2 Plus
Dpse\GA28049-PA 227 GA28049-PA 1..156 1..166 626 84.3 Plus
Dpse\GA28048-PA 227 GA28048-PA 1..156 1..166 626 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16376-PA 268 GM16376-PA 1..268 1..265 1238 98.9 Plus
Dsec\GM16375-PA 334 GM16375-PA 1..290 1..265 1109 89.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21369-PA 271 GD21369-PA 1..271 1..265 1228 97.4 Plus
Dsim\Mst98Cb-PA 334 GD21368-PA 1..290 1..265 1109 89.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19633-PA 333 GJ19633-PA 1..333 1..265 966 69.8 Plus
Dvir\GJ21217-PA 276 GJ21217-PA 1..203 1..203 962 98 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22644-PA 330 GK22644-PA 1..255 1..239 988 86 Plus
Dwil\GK24788-PA 306 GK24788-PA 2..122 11..135 526 88 Plus
Dwil\GK22645-PA 224 GK22645-PA 13..149 119..239 414 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23782-PA 262 GE23782-PA 1..262 1..265 1211 97.4 Plus
Dyak\GE23781-PA 334 GE23781-PA 1..330 1..264 990 72.7 Plus