Clone LP11175 Report

Search the DGRC for LP11175

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:111
Well:75
Vector:pOT2
Associated Gene/TranscriptEig71Ec-RA
Protein status:LP11175.pep: gold
Preliminary Size:798
Sequenced Size:660

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7608 2002-01-01 Sim4 clustering to Release 2
CG7608 2003-01-01 Sim4 clustering to Release 3
CG7608 2003-04-22 Blastp of sequenced clone
Eig71Ec 2008-04-29 Release 5.5 accounting
Eig71Ec 2008-08-15 Release 5.9 accounting
Eig71Ec 2008-12-18 5.12 accounting

Clone Sequence Records

LP11175.complete Sequence

660 bp (660 high quality bases) assembled on 2003-04-22

GenBank Submission: AY069753

> LP11175.complete
TTGTCAGTAGCAGTACCAACATGTCGAAAATTACTCTCATTTTTGCTATT
CTCTGCCTTTGCGTGGCTGTTCAGGCTCAAACTCGTGAACAAGAAATTTG
CCGTCAAGAAAACGAAACTTGCCGTCGAAATGAACGGAGATTGGGAGTTC
AAAATGATGTTTCGACCACATTTAATAATCACTGCCGCCGCCAGTCAGGC
ATTCGAAACTGGCGAAATGTCTCTCGTTGCGAATTGTCTCTGGCTACTTG
TCGATTGACACTCGAGCGTTGTGCTGTTATAAACTGCAAAAATGTGAGAA
ACAGCATTGATGGTGGGGTCACCGCTCGCCCTCCAACTTCAAGGAGGACA
ACCCGGCGAATTCCTGACACCCGACGACCTCGAACTACTCGTAGGACCCC
AACTACCCGTCGTGCTCCAACTACTAGATCTTCTCGTAGAACTACACGTC
GTCGTGCTCCAACAACTAGAACTACTCGAAGAACTACACGTCGTCGTGCG
CCAACTACTAGAACTACGACTCGTCGACCTACTGAAGAATAACTCCTAGA
ACCATTTCATTCAGAGTAATATCCTGCAAAATGTATCCTGCTGAAAAACA
ATAAAAACTTTAATGCTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

LP11175.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ec-RA 759 Eig71Ec-RA 60..682 1..623 3115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15641381..15641745 620..256 1825 100 Minus
chr3L 24539361 chr3L 15641824..15642040 255..39 1070 99.5 Minus
chr3L 24539361 chr3L 15641484..15641551 475..408 250 91.2 Minus
chr3L 24539361 chr3L 15641526..15641593 517..450 250 91.2 Minus
chr3L 24539361 chr3L 15642093..15642137 45..1 225 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15651476..15651843 623..256 1840 100 Minus
3L 28110227 3L 15651922..15652138 255..39 1070 99.5 Minus
3L 28110227 3L 15651582..15651649 475..408 250 91.2 Minus
3L 28110227 3L 15651624..15651691 517..450 250 91.2 Minus
3L 28110227 3L 15652191..15652235 45..1 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15644576..15644943 623..256 1840 100 Minus
3L 28103327 3L 15645022..15645238 255..39 1070 99.5 Minus
3L 28103327 3L 15645291..15645335 45..1 225 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:23:28 has no hits.

LP11175.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:24:25 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15641381..15641745 256..620 100 <- Minus
chr3L 15641824..15642033 46..255 100 <- Minus
chr3L 15642093..15642137 1..45 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:15 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 1..522 21..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:35 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 1..522 21..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:20:43 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 1..522 21..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:01 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 1..522 21..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:44:39 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 1..522 21..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:40 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 17..636 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:35 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 20..639 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:20:43 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 20..639 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:01 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 17..636 1..620 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:44:39 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ec-RA 20..639 1..620 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:25 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15651479..15651843 256..620 100 <- Minus
3L 15651922..15652131 46..255 100 <- Minus
3L 15652191..15652235 1..45 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:25 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15651479..15651843 256..620 100 <- Minus
3L 15651922..15652131 46..255 100 <- Minus
3L 15652191..15652235 1..45 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:24:25 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15651479..15651843 256..620 100 <- Minus
3L 15651922..15652131 46..255 100 <- Minus
3L 15652191..15652235 1..45 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:20:43 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15644579..15644943 256..620 100 <- Minus
arm_3L 15645022..15645231 46..255 100 <- Minus
arm_3L 15645291..15645335 1..45 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:06 Download gff for LP11175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15644579..15644943 256..620 100 <- Minus
3L 15645022..15645231 46..255 100 <- Minus
3L 15645291..15645335 1..45 100   Minus

LP11175.hyp Sequence

Translation from 2 to 541

> LP11175.hyp
VSSSTNMSKITLIFAILCLCVAVQAQTREQEICRQENETCRRNERRLGVQ
NDVSTTFNNHCRRQSGIRNWRNVSRCELSLATCRLTLERCAVINCKNVRN
SIDGGVTARPPTSRRTTRRIPDTRRPRTTRRTPTTRRAPTTRSSRRTTRR
RAPTTRTTRRTTRRRAPTTRTTTRRPTEE*

LP11175.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ec-PA 173 CG7608-PA 1..173 7..179 905 100 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 7..102 241 51 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 7..102 241 51 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 7..98 170 41.2 Plus
Eig71Ei-PA 102 CG7327-PA 1..95 7..98 170 41.2 Plus

LP11175.pep Sequence

Translation from 20 to 541

> LP11175.pep
MSKITLIFAILCLCVAVQAQTREQEICRQENETCRRNERRLGVQNDVSTT
FNNHCRRQSGIRNWRNVSRCELSLATCRLTLERCAVINCKNVRNSIDGGV
TARPPTSRRTTRRIPDTRRPRTTRRTPTTRRAPTTRSSRRTTRRRAPTTR
TTRRTTRRRAPTTRTTTRRPTEE*

LP11175.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24086-PA 100 GF24086-PA 1..97 1..99 260 54.5 Plus
Dana\GF24089-PA 122 GF24089-PA 40..120 15..96 164 45.8 Plus
Dana\GF10383-PA 183 GF10383-PA 24..95 4..78 141 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13529-PA 270 GG13529-PA 1..81 1..81 379 86.4 Plus
Dere\GG15917-PA 94 GG15917-PA 1..90 1..93 201 47.3 Plus
Dere\GG15920-PA 98 GG15920-PA 1..96 1..96 171 38.8 Plus
Dere\GG15921-PA 102 GG15921-PA 1..97 1..94 152 40.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ec-PA 173 CG7608-PA 1..173 1..173 905 100 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 1..96 241 51 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 1..96 241 51 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 1..92 170 41.2 Plus
Eig71Ei-PA 102 CG7327-PA 1..95 1..92 170 41.2 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 1..96 165 33.7 Plus
Eig71Ek-PA 97 CG7325-PA 4..96 7..97 147 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13624-PA 97 GI13624-PA 1..97 1..97 186 44.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15724-PA 132 GL15724-PA 4..97 7..99 214 49 Plus
Dper\GL25493-PA 192 GL25493-PA 1..80 1..79 211 48.8 Plus
Dper\GL24996-PA 98 GL24996-PA 20..89 17..90 134 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20289-PA 216 GA20289-PA 1..104 1..99 243 46.2 Plus
Dpse\GA23777-PA 138 GA23777-PA 1..100 1..99 242 52 Plus
Dpse\GA20272-PA 95 GA20272-PA 20..95 17..96 141 41.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24473-PA 162 GM24473-PA 1..115 1..116 532 89.7 Plus
Dsec\GM25549-PA 94 GM25549-PA 1..93 1..96 215 51 Plus
Dsec\GM25551-PA 100 GM25551-PA 1..98 1..96 141 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12547-PA 162 GD12547-PA 1..145 1..146 543 88.4 Plus
Dsim\GD14562-PA 94 GD14562-PA 1..90 1..93 207 51.6 Plus
Dsim\GD14565-PA 102 GD14565-PA 1..95 1..92 154 40.2 Plus
Dsim\GD14564-PA 98 GD14564-PA 1..96 1..96 152 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13962-PA 94 GJ13962-PA 1..94 1..98 175 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20719-PA 124 GK20719-PA 1..98 1..99 220 44 Plus
Dwil\GK15233-PA 98 GK15233-PA 1..92 1..92 168 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19824-PA 186 GE19824-PA 1..112 1..116 446 76.7 Plus
Dyak\GE22832-PA 193 GE22832-PA 1..112 1..116 417 78.4 Plus
Dyak\GE22264-PA 95 GE22264-PA 1..90 1..93 211 52.7 Plus
Dyak\GE23154-PA 95 GE23154-PA 1..90 1..93 207 52.7 Plus
Dyak\GE22266-PA 98 GE22266-PA 1..96 1..96 170 38.8 Plus