BDGP Sequence Production Resources |
Search the DGRC for LP11175
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 111 |
Well: | 75 |
Vector: | pOT2 |
Associated Gene/Transcript | Eig71Ec-RA |
Protein status: | LP11175.pep: gold |
Preliminary Size: | 798 |
Sequenced Size: | 660 |
Gene | Date | Evidence |
---|---|---|
CG7608 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7608 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7608 | 2003-04-22 | Blastp of sequenced clone |
Eig71Ec | 2008-04-29 | Release 5.5 accounting |
Eig71Ec | 2008-08-15 | Release 5.9 accounting |
Eig71Ec | 2008-12-18 | 5.12 accounting |
660 bp (660 high quality bases) assembled on 2003-04-22
GenBank Submission: AY069753
> LP11175.complete TTGTCAGTAGCAGTACCAACATGTCGAAAATTACTCTCATTTTTGCTATT CTCTGCCTTTGCGTGGCTGTTCAGGCTCAAACTCGTGAACAAGAAATTTG CCGTCAAGAAAACGAAACTTGCCGTCGAAATGAACGGAGATTGGGAGTTC AAAATGATGTTTCGACCACATTTAATAATCACTGCCGCCGCCAGTCAGGC ATTCGAAACTGGCGAAATGTCTCTCGTTGCGAATTGTCTCTGGCTACTTG TCGATTGACACTCGAGCGTTGTGCTGTTATAAACTGCAAAAATGTGAGAA ACAGCATTGATGGTGGGGTCACCGCTCGCCCTCCAACTTCAAGGAGGACA ACCCGGCGAATTCCTGACACCCGACGACCTCGAACTACTCGTAGGACCCC AACTACCCGTCGTGCTCCAACTACTAGATCTTCTCGTAGAACTACACGTC GTCGTGCTCCAACAACTAGAACTACTCGAAGAACTACACGTCGTCGTGCG CCAACTACTAGAACTACGACTCGTCGACCTACTGAAGAATAACTCCTAGA ACCATTTCATTCAGAGTAATATCCTGCAAAATGTATCCTGCTGAAAAACA ATAAAAACTTTAATGCTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ec-RA | 759 | Eig71Ec-RA | 60..682 | 1..623 | 3115 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15641381..15641745 | 620..256 | 1825 | 100 | Minus |
chr3L | 24539361 | chr3L | 15641824..15642040 | 255..39 | 1070 | 99.5 | Minus |
chr3L | 24539361 | chr3L | 15641484..15641551 | 475..408 | 250 | 91.2 | Minus |
chr3L | 24539361 | chr3L | 15641526..15641593 | 517..450 | 250 | 91.2 | Minus |
chr3L | 24539361 | chr3L | 15642093..15642137 | 45..1 | 225 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15651476..15651843 | 623..256 | 1840 | 100 | Minus |
3L | 28110227 | 3L | 15651922..15652138 | 255..39 | 1070 | 99.5 | Minus |
3L | 28110227 | 3L | 15651582..15651649 | 475..408 | 250 | 91.2 | Minus |
3L | 28110227 | 3L | 15651624..15651691 | 517..450 | 250 | 91.2 | Minus |
3L | 28110227 | 3L | 15652191..15652235 | 45..1 | 225 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15644576..15644943 | 623..256 | 1840 | 100 | Minus |
3L | 28103327 | 3L | 15645022..15645238 | 255..39 | 1070 | 99.5 | Minus |
3L | 28103327 | 3L | 15645291..15645335 | 45..1 | 225 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15641381..15641745 | 256..620 | 100 | <- | Minus |
chr3L | 15641824..15642033 | 46..255 | 100 | <- | Minus |
chr3L | 15642093..15642137 | 1..45 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 1..522 | 21..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 1..522 | 21..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 1..522 | 21..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 1..522 | 21..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 1..522 | 21..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 17..636 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 20..639 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 20..639 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 17..636 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ec-RA | 20..639 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15651479..15651843 | 256..620 | 100 | <- | Minus |
3L | 15651922..15652131 | 46..255 | 100 | <- | Minus |
3L | 15652191..15652235 | 1..45 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15651479..15651843 | 256..620 | 100 | <- | Minus |
3L | 15651922..15652131 | 46..255 | 100 | <- | Minus |
3L | 15652191..15652235 | 1..45 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15651479..15651843 | 256..620 | 100 | <- | Minus |
3L | 15651922..15652131 | 46..255 | 100 | <- | Minus |
3L | 15652191..15652235 | 1..45 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15644579..15644943 | 256..620 | 100 | <- | Minus |
arm_3L | 15645022..15645231 | 46..255 | 100 | <- | Minus |
arm_3L | 15645291..15645335 | 1..45 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15644579..15644943 | 256..620 | 100 | <- | Minus |
3L | 15645022..15645231 | 46..255 | 100 | <- | Minus |
3L | 15645291..15645335 | 1..45 | 100 | Minus |
Translation from 2 to 541
> LP11175.hyp VSSSTNMSKITLIFAILCLCVAVQAQTREQEICRQENETCRRNERRLGVQ NDVSTTFNNHCRRQSGIRNWRNVSRCELSLATCRLTLERCAVINCKNVRN SIDGGVTARPPTSRRTTRRIPDTRRPRTTRRTPTTRRAPTTRSSRRTTRR RAPTTRTTRRTTRRRAPTTRTTTRRPTEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ec-PA | 173 | CG7608-PA | 1..173 | 7..179 | 905 | 100 | Plus |
Eig71Eb-PB | 95 | CG7355-PB | 1..93 | 7..102 | 241 | 51 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..93 | 7..102 | 241 | 51 | Plus |
Eig71Ei-PB | 102 | CG7327-PB | 1..95 | 7..98 | 170 | 41.2 | Plus |
Eig71Ei-PA | 102 | CG7327-PA | 1..95 | 7..98 | 170 | 41.2 | Plus |
Translation from 20 to 541
> LP11175.pep MSKITLIFAILCLCVAVQAQTREQEICRQENETCRRNERRLGVQNDVSTT FNNHCRRQSGIRNWRNVSRCELSLATCRLTLERCAVINCKNVRNSIDGGV TARPPTSRRTTRRIPDTRRPRTTRRTPTTRRAPTTRSSRRTTRRRAPTTR TTRRTTRRRAPTTRTTTRRPTEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24086-PA | 100 | GF24086-PA | 1..97 | 1..99 | 260 | 54.5 | Plus |
Dana\GF24089-PA | 122 | GF24089-PA | 40..120 | 15..96 | 164 | 45.8 | Plus |
Dana\GF10383-PA | 183 | GF10383-PA | 24..95 | 4..78 | 141 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13529-PA | 270 | GG13529-PA | 1..81 | 1..81 | 379 | 86.4 | Plus |
Dere\GG15917-PA | 94 | GG15917-PA | 1..90 | 1..93 | 201 | 47.3 | Plus |
Dere\GG15920-PA | 98 | GG15920-PA | 1..96 | 1..96 | 171 | 38.8 | Plus |
Dere\GG15921-PA | 102 | GG15921-PA | 1..97 | 1..94 | 152 | 40.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ec-PA | 173 | CG7608-PA | 1..173 | 1..173 | 905 | 100 | Plus |
Eig71Eb-PB | 95 | CG7355-PB | 1..93 | 1..96 | 241 | 51 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..93 | 1..96 | 241 | 51 | Plus |
Eig71Ei-PB | 102 | CG7327-PB | 1..95 | 1..92 | 170 | 41.2 | Plus |
Eig71Ei-PA | 102 | CG7327-PA | 1..95 | 1..92 | 170 | 41.2 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..96 | 1..96 | 165 | 33.7 | Plus |
Eig71Ek-PA | 97 | CG7325-PA | 4..96 | 7..97 | 147 | 34.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13624-PA | 97 | GI13624-PA | 1..97 | 1..97 | 186 | 44.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15724-PA | 132 | GL15724-PA | 4..97 | 7..99 | 214 | 49 | Plus |
Dper\GL25493-PA | 192 | GL25493-PA | 1..80 | 1..79 | 211 | 48.8 | Plus |
Dper\GL24996-PA | 98 | GL24996-PA | 20..89 | 17..90 | 134 | 41.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20289-PA | 216 | GA20289-PA | 1..104 | 1..99 | 243 | 46.2 | Plus |
Dpse\GA23777-PA | 138 | GA23777-PA | 1..100 | 1..99 | 242 | 52 | Plus |
Dpse\GA20272-PA | 95 | GA20272-PA | 20..95 | 17..96 | 141 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24473-PA | 162 | GM24473-PA | 1..115 | 1..116 | 532 | 89.7 | Plus |
Dsec\GM25549-PA | 94 | GM25549-PA | 1..93 | 1..96 | 215 | 51 | Plus |
Dsec\GM25551-PA | 100 | GM25551-PA | 1..98 | 1..96 | 141 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12547-PA | 162 | GD12547-PA | 1..145 | 1..146 | 543 | 88.4 | Plus |
Dsim\GD14562-PA | 94 | GD14562-PA | 1..90 | 1..93 | 207 | 51.6 | Plus |
Dsim\GD14565-PA | 102 | GD14565-PA | 1..95 | 1..92 | 154 | 40.2 | Plus |
Dsim\GD14564-PA | 98 | GD14564-PA | 1..96 | 1..96 | 152 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13962-PA | 94 | GJ13962-PA | 1..94 | 1..98 | 175 | 39.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20719-PA | 124 | GK20719-PA | 1..98 | 1..99 | 220 | 44 | Plus |
Dwil\GK15233-PA | 98 | GK15233-PA | 1..92 | 1..92 | 168 | 43.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19824-PA | 186 | GE19824-PA | 1..112 | 1..116 | 446 | 76.7 | Plus |
Dyak\GE22832-PA | 193 | GE22832-PA | 1..112 | 1..116 | 417 | 78.4 | Plus |
Dyak\GE22264-PA | 95 | GE22264-PA | 1..90 | 1..93 | 211 | 52.7 | Plus |
Dyak\GE23154-PA | 95 | GE23154-PA | 1..90 | 1..93 | 207 | 52.7 | Plus |
Dyak\GE22266-PA | 98 | GE22266-PA | 1..96 | 1..96 | 170 | 38.8 | Plus |