Clone LP11234 Report

Search the DGRC for LP11234

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:112
Well:34
Vector:pOT2
Associated Gene/TranscriptOscillin-RA
Protein status:LP11234.pep: gold
Preliminary Size:1329
Sequenced Size:1237

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6957 2001-01-01 Release 2 assignment
CG6957 2002-06-12 Blastp of sequenced clone
CG6957 2003-01-01 Sim4 clustering to Release 3
Oscillin 2008-04-29 Release 5.5 accounting
Oscillin 2008-08-15 Release 5.9 accounting
Oscillin 2008-12-18 5.12 accounting

Clone Sequence Records

LP11234.complete Sequence

1237 bp (1237 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122220

> LP11234.complete
CTCTTTTTCTCTCTCTTATTCCAACCGCAGCCGCAAAAACAAACTCAAAC
TCGAGCTAATCGCTGCATAAATTTGCTGTTCGAATTGAACAATTGAACAG
TCTCAGTTAGCAGCTGAAATCGGAAATAAGCGACAAAAGCAGCAGTGCGA
GCAAAAATCAAGTAATAATAATCATCAATAAGCAGCTGTTTGCATTCGCG
TGTTTTGAAGCTTAACAATGAGATTGGTCATCTTGGAAACCAGCGACTCG
GTGGGCAAGTGGGCGGCCAAATATGTGATGAAACGCATCAATGACTTTCA
GCCGAGTGCCGACAGATACTTCGTTTTGGGCCTGCCCACGGGATCTACGC
CATTGGGAATGTACAAAGAACTGATCGAGTTTCATAAGCAGGGCAAGGTA
TCCTTTCAGTATGTGAAAACCTTCAATATGGATGAGTATGTGGGACTGGC
CAGAGATCACCATGAGAGCTATCACTACTTCATGTGGAACAACTTCTTCA
AGCACATCGACATTGAGCCCAAGAATGTGCACATTTTGGATGGCAATGCA
GCTGATCTGGTGGCCGAGTGCAATAAGTTCGAGGATCAGATCCGCGAGGC
TGGAGGAGTGGAGCTGTTCATCGGTGGCATCGGACCCGATGGCCATATTG
CCTTCAATGAGCCCGGCTCCTCATTGGTGTCCCGAACGCGGGTGAAAACT
CTGGCGCAGGATACACTTGAAGCGAATGCCCGTTTCTTTGACAACGATAT
GAGCAAGGTGCCCAAACAGGCTTTAACCGTGGGCGTTGGCACTGTGATGG
ACTCCAAGGAGGTGATGATCCTCATCACCGGAGCTCACAAGGCATTTGCC
CTGTACAAGGCCATCGAGGAGGGTGTGAATCACATGTGGACCGTCAGTGC
CTTCCAGCAGCATGCAAATACCCTGATGATCTGCGACGAGGATGCCACTT
TGGAGCTGAGAGTTAAGACCGTTAAATATTTCAAGGGCATTCTCAGAGAT
CTAGACGAAGGCTCCCCACTGGAGGGCTACAAAAACTGATAATGCAGTCT
GATGGACGTCCATTCCAAGCTGATAGAGCAACAAAAGACGACGTAACCCC
AGATACTAAAGGGAATAATGGAGATCTGGATTCCATCGTTACCAGCATTA
TAGTTTTTTCAATCAAAAGGAATCGAATTTTTATACAATAAATGAATTTT
TATATGTTATCGCCTTAAAAAAAAAAAAAAAAAAAAA

LP11234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Oscillin-RA 1425 Oscillin-RA 120..1338 1..1219 6095 100 Plus
Oscillin-RB 1638 Oscillin-RB 617..1627 209..1219 5055 100 Plus
Oscillin.d 1365 Oscillin.d 120..1104 1..985 4925 100 Plus
Oscillin-RB 1638 Oscillin-RB 14..223 1..210 1050 100 Plus
Oscillin.d 1365 Oscillin.d 1105..1278 1046..1219 870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5547265..5547808 443..986 2720 100 Plus
chr2L 23010047 chr2L 5546301..5546510 1..210 1050 100 Plus
chr2L 23010047 chr2L 5548542..5548712 1046..1216 855 100 Plus
chr2L 23010047 chr2L 5547069..5547199 314..444 655 100 Plus
chr2L 23010047 chr2L 5546904..5547010 209..315 535 100 Plus
chr2L 23010047 chr2L 5548113..5548174 984..1045 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5548167..5548710 443..986 2720 100 Plus
2L 23513712 2L 5547203..5547412 1..210 1050 100 Plus
2L 23513712 2L 5549444..5549617 1046..1219 870 100 Plus
2L 23513712 2L 5547971..5548101 314..444 655 100 Plus
2L 23513712 2L 5547806..5547912 209..315 535 100 Plus
2L 23513712 2L 5549015..5549076 984..1045 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5548167..5548710 443..986 2720 100 Plus
2L 23513712 2L 5547203..5547412 1..210 1050 100 Plus
2L 23513712 2L 5549444..5549617 1046..1219 870 100 Plus
2L 23513712 2L 5547971..5548101 314..444 655 100 Plus
2L 23513712 2L 5547806..5547912 209..315 535 100 Plus
2L 23513712 2L 5549015..5549076 984..1045 310 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:27 has no hits.

LP11234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:27 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5546301..5546510 1..210 100 -> Plus
chr2L 5546906..5547010 211..315 100 -> Plus
chr2L 5547071..5547198 316..443 100 -> Plus
chr2L 5547266..5547807 444..985 100 -> Plus
chr2L 5548115..5548174 986..1045 100 -> Plus
chr2L 5548542..5548712 1046..1216 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:19 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RB 1..822 218..1039 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:14 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RB 1..822 218..1039 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:18 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RC 1..822 218..1039 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:01 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RB 1..822 218..1039 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:07 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RC 1..822 218..1039 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:48:49 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:14 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:18 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:01 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:07 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
Oscillin-RA 1..1216 1..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:27 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5547203..5547412 1..210 100 -> Plus
2L 5547808..5547912 211..315 100 -> Plus
2L 5547973..5548100 316..443 100 -> Plus
2L 5548168..5548709 444..985 100 -> Plus
2L 5549017..5549076 986..1045 100 -> Plus
2L 5549444..5549614 1046..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:27 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5547203..5547412 1..210 100 -> Plus
2L 5547808..5547912 211..315 100 -> Plus
2L 5547973..5548100 316..443 100 -> Plus
2L 5548168..5548709 444..985 100 -> Plus
2L 5549017..5549076 986..1045 100 -> Plus
2L 5549444..5549614 1046..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:27 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5547203..5547412 1..210 100 -> Plus
2L 5547808..5547912 211..315 100 -> Plus
2L 5547973..5548100 316..443 100 -> Plus
2L 5548168..5548709 444..985 100 -> Plus
2L 5549017..5549076 986..1045 100 -> Plus
2L 5549444..5549614 1046..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:18 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5547973..5548100 316..443 100 -> Plus
arm_2L 5547203..5547412 1..210 100 -> Plus
arm_2L 5547808..5547912 211..315 100 -> Plus
arm_2L 5548168..5548709 444..985 100 -> Plus
arm_2L 5549017..5549076 986..1045 100 -> Plus
arm_2L 5549444..5549614 1046..1216 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:46 Download gff for LP11234.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5547203..5547412 1..210 100 -> Plus
2L 5547808..5547912 211..315 100 -> Plus
2L 5547973..5548100 316..443 100 -> Plus
2L 5548168..5548709 444..985 100 -> Plus
2L 5549017..5549076 986..1045 100 -> Plus
2L 5549444..5549614 1046..1216 100   Plus

LP11234.hyp Sequence

Translation from 217 to 1038

> LP11234.hyp
MRLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYK
ELIEFHKQGKVSFQYVKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIE
PKNVHILDGNAADLVAECNKFEDQIREAGGVELFIGGIGPDGHIAFNEPG
SSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMDSKEVM
ILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTLMICDEDATLELRVK
TVKYFKGILRDLDEGSPLEGYKN*

LP11234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Oscillin-PH 273 CG6957-PH 1..273 1..273 1434 100 Plus
Oscillin-PF 273 CG6957-PF 1..273 1..273 1434 100 Plus
Oscillin-PC 273 CG6957-PC 1..273 1..273 1434 100 Plus
Oscillin-PB 273 CG6957-PB 1..273 1..273 1434 100 Plus
Oscillin-PA 273 CG6957-PA 1..273 1..273 1434 100 Plus

LP11234.pep Sequence

Translation from 217 to 1038

> LP11234.pep
MRLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYK
ELIEFHKQGKVSFQYVKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIE
PKNVHILDGNAADLVAECNKFEDQIREAGGVELFIGGIGPDGHIAFNEPG
SSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMDSKEVM
ILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTLMICDEDATLELRVK
TVKYFKGILRDLDEGSPLEGYKN*

LP11234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15148-PA 273 GF15148-PA 1..273 1..273 1402 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25080-PA 273 GG25080-PA 1..273 1..273 1443 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10296-PA 280 GH10296-PA 1..274 1..273 1308 88.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Oscillin-PH 273 CG6957-PH 1..273 1..273 1434 100 Plus
Oscillin-PF 273 CG6957-PF 1..273 1..273 1434 100 Plus
Oscillin-PC 273 CG6957-PC 1..273 1..273 1434 100 Plus
Oscillin-PB 273 CG6957-PB 1..273 1..273 1434 100 Plus
Oscillin-PA 273 CG6957-PA 1..273 1..273 1434 100 Plus
Oscillin-PG 272 CG6957-PG 1..259 1..259 1348 98.8 Plus
Oscillin-PD 272 CG6957-PD 1..259 1..259 1348 98.8 Plus
Oscillin-PE 266 CG6957-PE 1..256 1..256 1344 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17992-PA 276 GI17992-PA 1..271 1..271 1320 90.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25853-PA 274 GL25853-PA 1..274 1..273 1370 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19983-PA 274 GA19983-PA 1..274 1..273 1374 93.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18555-PA 273 GM18555-PA 1..273 1..273 1447 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23349-PA 803 GD23349-PA 564..803 34..273 1290 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19587-PA 278 GJ19587-PA 1..273 1..273 1305 87.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21107-PA 273 GK21107-PA 1..273 1..273 1357 90.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25482-PA 273 GE25482-PA 1..273 1..273 1459 98.9 Plus