Clone LP11415 Report

Search the DGRC for LP11415

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:114
Well:15
Vector:pOT2
Associated Gene/TranscriptSclp-RA
Protein status:LP11415.pep: gold
Preliminary Size:1312
Sequenced Size:1120

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2471 2001-01-01 Release 2 assignment
CG2471 2003-01-01 Sim4 clustering to Release 3
CG2471 2003-02-22 Blastp of sequenced clone
Sclp 2008-04-29 Release 5.5 accounting
Sclp 2008-08-15 Release 5.9 accounting
Sclp 2008-12-18 5.12 accounting

Clone Sequence Records

LP11415.complete Sequence

1120 bp (1120 high quality bases) assembled on 2003-02-22

GenBank Submission: AY061562

> LP11415.complete
AGATAGTCACGTTCAGTTGGTTGCGAAGTAGCTCGCGTTTAAACAATCCA
AATAATAGGAAAGATATATCTTGAACCAATCACACTTGCCACACTGATTG
GAAATACAAAAACACACATATTTTTTTTCGAGTGATTACCCAGTGAGACA
AAGCCAAATTAATATACCCACACCAAAGACTAGTTCAAATCAATCGAAAA
CAAAAAAAAAACACAAAAGATGCGGCCTTTTGGCAACGACATAACAAACA
TCCCGAACGGTGGTAATAATGGTGGTAATAATGGTGGTAATAATGGCAAC
AACGATCCCAACGACGGCAACGACAACCGGAACACGAACATATCCAGTGA
GGATCCCAGCGAGGAGTCCGGACTATCGGACGATCCGAGTATTCCGCCGC
ATATAGCGAGAATCGGCGGAATCGTTACCTGCCCCCCGATCGCTGGACAA
GGAGTTATCCGGGTGGTTCAGCGTTGCGAAGACGCCAAGGAGAACCACAA
ACTGGATCTTTCAAGTTGTGAACTGATGCAAATACCAGATGCGGTATATC
ATCTTATGCGAAACACAGAGTTGATCACCTGCAATCTCAGTGGCAATGTG
CTCAAAAGCGTTTCGCCCAAGTTTTCGCAAAAGTTTAGTACCATCACAGA
TCTTAATCTGTCACACAACAAACTGTCGAGGCTGCCAGAAGAATTCGCCA
GCTTGTCTGCGCTAACCAAGCTGAATATCTCGAACAATTCATTTATCGTT
TTGCCACAAGTAGTCTTTAAGCTTCAGAGTCTTGCCAGTCTGGATGCCCA
GAACAATGCCATTTTGGAAATTGATACCGATGAGGCAATTACCAGTGACA
ATTTGGCCCTCGTTGATCTTCGGAATAATCCGCTGAGCAGAAACTGCCGA
CGAAAGCTGCAGAGCTTCAAGACCCCCTTCCACCTTGAGATCTCCAAGGA
TGTCGAAGACGACTGGTAAACCGGATGAATGTCCTGTCCATTCATTTTCC
AACACACCACAAACAAATCTCTCGTTATCTCGAAAGAGAGCGCCCTAAAC
GGCCCTCCTTCAACTTATTTATTCTGTTTATAAATTTATATATATATTTA
TCAAAAAAAAAAAAAAAAAA

LP11415.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-RA 1172 Sclp-RA 21..1127 1..1107 5535 100 Plus
Sclp-RB 836 Sclp-RB 189..791 505..1107 3015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11815294..11815794 505..1 2415 99 Minus
chrX 22417052 chrX 11812787..11813072 1102..817 1430 100 Minus
chrX 22417052 chrX 11813137..11813307 817..647 840 99.4 Minus
chrX 22417052 chrX 11813369..11813513 649..505 695 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11924158..11924662 505..1 2525 100 Minus
X 23542271 X 11921642..11921932 1107..817 1455 100 Minus
X 23542271 X 11921998..11922168 817..647 855 100 Minus
X 23542271 X 11922230..11922374 649..505 725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11932256..11932760 505..1 2525 100 Minus
X 23527363 X 11929740..11930030 1107..817 1455 100 Minus
X 23527363 X 11930096..11930266 817..647 855 100 Minus
X 23527363 X 11930328..11930472 649..505 725 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:15:56 has no hits.

LP11415.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:17:15 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11812814..11813071 818..1075 100 <- Minus
chrX 11813137..11813304 650..817 99 <- Minus
chrX 11813369..11813512 506..649 98 <- Minus
chrX 11815294..11815794 1..505 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:22 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..750 220..969 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:39 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..750 220..969 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:57:57 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..750 220..969 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:03 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..750 220..969 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:26 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..750 220..969 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:06 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..1102 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:39 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..1102 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:57 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..1102 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:03 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..1102 1..1102 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:26 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 1..1102 1..1102 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:15 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
X 11922230..11922373 506..649 100 <- Minus
X 11921647..11921931 818..1102 100 <- Minus
X 11921998..11922165 650..817 100 <- Minus
X 11924158..11924662 1..505 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:15 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
X 11922230..11922373 506..649 100 <- Minus
X 11921647..11921931 818..1102 100 <- Minus
X 11921998..11922165 650..817 100 <- Minus
X 11924158..11924662 1..505 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:15 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
X 11922230..11922373 506..649 100 <- Minus
X 11921647..11921931 818..1102 100 <- Minus
X 11921998..11922165 650..817 100 <- Minus
X 11924158..11924662 1..505 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:57 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11815680..11815964 818..1102 100 <- Minus
arm_X 11816031..11816198 650..817 100 <- Minus
arm_X 11816263..11816406 506..649 100 <- Minus
arm_X 11818191..11818695 1..505 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:25 Download gff for LP11415.complete
Subject Subject Range Query Range Percent Splice Strand
X 11929745..11930029 818..1102 100 <- Minus
X 11930096..11930263 650..817 100 <- Minus
X 11930328..11930471 506..649 100 <- Minus
X 11932256..11932760 1..505 100   Minus

LP11415.pep Sequence

Translation from 219 to 968

> LP11415.pep
MRPFGNDITNIPNGGNNGGNNGGNNGNNDPNDGNDNRNTNISSEDPSEES
GLSDDPSIPPHIARIGGIVTCPPIAGQGVIRVVQRCEDAKENHKLDLSSC
ELMQIPDAVYHLMRNTELITCNLSGNVLKSVSPKFSQKFSTITDLNLSHN
KLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAILE
IDTDEAITSDNLALVDLRNNPLSRNCRRKLQSFKTPFHLEISKDVEDDW*

LP11415.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21583-PA 247 GF21583-PA 1..247 1..249 852 65.4 Plus
Dana\GF18150-PA 782 GF18150-PA 597..732 84..220 149 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18819-PA 246 GG18819-PA 1..246 1..249 1226 95.2 Plus
Dere\GG16778-PA 644 GG16778-PA 149..290 75..222 149 31.8 Plus
Dere\GG17029-PA 873 GG17029-PA 699..823 93..220 146 39.2 Plus
Dere\GG22967-PA 239 GG22967-PA 87..172 116..205 143 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11829-PA 256 GH11829-PA 1..246 1..242 833 72.4 Plus
Dgri\GH14049-PA 744 GH14049-PA 570..694 93..220 186 40.8 Plus
Dgri\GH21000-PA 237 GH21000-PA 75..171 110..206 159 41.8 Plus
Dgri\GH14049-PA 744 GH14049-PA 204..315 87..198 152 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-PC 339 CG2471-PC 1..249 1..249 1299 100 Plus
Sclp-PA 249 CG2471-PA 1..249 1..249 1299 100 Plus
Sclp-PB 175 CG2471-PB 5..175 79..249 828 95.3 Plus
f-cup-PE 620 CG9611-PE 446..572 93..222 192 38.2 Plus
f-cup-PB 650 CG9611-PB 476..602 93..222 192 38.2 Plus
f-cup-PA 693 CG9611-PA 519..645 93..222 192 38.2 Plus
f-cup-PG 759 CG9611-PG 585..711 93..222 192 38.2 Plus
f-cup-PF 802 CG9611-PF 628..754 93..222 192 38.2 Plus
Sur-8-PF 641 CG5407-PF 86..287 14..222 162 28 Plus
Sur-8-PB 641 CG5407-PB 86..287 14..222 162 28 Plus
Sur-8-PA 641 CG5407-PA 86..287 14..222 162 28 Plus
Sur-8-PE 694 CG5407-PE 86..287 14..222 162 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14772-PA 270 GI14772-PA 1..270 1..249 864 67.4 Plus
Dmoj\GI24424-PA 694 GI24424-PA 520..644 93..220 178 39.5 Plus
Dmoj\GI14449-PA 115 GI14449-PA 1..114 1..97 171 45.6 Plus
Dmoj\GI20638-PA 237 GI20638-PA 70..170 105..205 145 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15850-PA 249 GL15850-PA 1..249 1..249 784 63.5 Plus
Dper\GL15851-PA 152 GL15851-PA 6..122 127..239 236 48.7 Plus
Dper\GL24452-PA 655 GL24452-PA 481..605 93..220 153 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15374-PA 249 GA15374-PA 1..249 1..249 768 62.2 Plus
Dpse\GA23495-PA 200 GA23495-PA 13..172 82..239 339 46.9 Plus
Dpse\GA23498-PA 199 GA23498-PA 13..172 82..239 336 46.9 Plus
Dpse\GA26616-PA 655 GA26616-PA 481..605 93..220 157 40.8 Plus
Dpse\GA26616-PD 616 GA26616-PD 442..566 93..220 157 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13238-PA 249 GM13238-PA 1..249 1..249 1264 98 Plus
Dsec\GM15368-PA 683 GM15368-PA 149..290 75..222 150 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15956-PA 249 GD15956-PA 1..249 1..249 1264 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18740-PA 243 GJ18740-PA 1..243 1..249 932 73.9 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 572..700 89..220 174 38.3 Plus
Dvir\GJ21606-PA 237 GJ21606-PA 70..187 105..220 144 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10280-PA 267 GK10280-PA 1..267 1..249 883 69.7 Plus
Dwil\GK13066-PA 650 GK13066-PA 447..600 90..220 178 32.5 Plus
Dwil\GK19299-PA 163 GK19299-PA 1..113 108..220 168 38.9 Plus
Dwil\GK19345-PA 240 GK19345-PA 40..173 95..205 154 31.3 Plus
Dwil\GK13066-PA 650 GK13066-PA 102..213 87..198 147 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17583-PA 253 GE17583-PA 1..253 1..249 1094 93.3 Plus
Dyak\GE24170-PA 645 GE24170-PA 150..289 75..220 148 32.2 Plus

LP11415.hyp Sequence

Translation from 219 to 968

> LP11415.hyp
MRPFGNDITNIPNGGNNGGNNGGNNGNNDPNDGNDNRNTNISSEDPSEES
GLSDDPSIPPHIARIGGIVTCPPIAGQGVIRVVQRCEDAKENHKLDLSSC
ELMQIPDAVYHLMRNTELITCNLSGNVLKSVSPKFSQKFSTITDLNLSHN
KLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAILE
IDTDEAITSDNLALVDLRNNPLSRNCRRKLQSFKTPFHLEISKDVEDDW*

LP11415.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-PA 249 CG2471-PA 1..249 1..249 1299 100 Plus
Sclp-PC 339 CG2471-PC 1..249 1..249 1299 100 Plus
Sclp-PB 175 CG2471-PB 5..175 79..249 828 95.3 Plus
f-cup-PE 620 CG9611-PE 446..572 93..222 192 38.2 Plus
f-cup-PB 650 CG9611-PB 476..602 93..222 192 38.2 Plus