Clone LP11469 Report

Search the DGRC for LP11469

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:114
Well:69
Vector:pOT2
Associated Gene/TranscriptCG7694-RA
Protein status:LP11469.pep: gold
Sequenced Size:640

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7694 2002-10-31 Blastp of sequenced clone
CG7694 2008-04-29 Release 5.5 accounting
CG7694 2008-08-15 Release 5.9 accounting
fray 2008-08-15 Release 5.9 accounting
CG7694 2008-12-18 5.12 accounting
fray 2008-12-18 5.12 accounting

Clone Sequence Records

LP11469.complete Sequence

640 bp (640 high quality bases) assembled on 2002-10-31

GenBank Submission: BT001518

> LP11469.complete
TGTGAAATTGCTTTTTCGGCGATTGGATTTTCATCGATTTTGCAAAGGGA
AAACAGGTTTTAAGAGGAGAACTGCCATGTCCGACTACTTCGAGGAACTG
GGTCATGAACCCACTGGACCACTGGGCGCAAACGATTTGGCCAGAAATCT
AAAGCGCCTTCAGGTTTTGGCCATCATGAATGGCATCGATATGGAGATCG
AGGTGCCAGAGGCCTCCAAGCGAGCCATTCTGGAGCTACCAGTTCATGAA
ATCGTCAAATCGGACGAGGGCGGCGATTTGGAGTGCTCTGTGTGCAAGGA
GCCAGCTGAAGAGGGCCAGAAGTACAGGATCCTTCCATGCAAGCACGAGT
TCCACGAGGAGTGCATCCTGCTCTGGCTGAAGAAGACGAATTCCTGTCCT
CTGTGTCGCTATGAACTGGAAACTGATGATCCTGTTTACGAGGAGTTGCG
CAGGTTTAGGCAGGATGAAGCTAACCGACGGGAGCGGGAGAACACTCTTT
TGGATTCCATGTTCGGCTAACTTGGAGTTAATCGATTCGACAGCGGTATT
TGGTCAAATTTGTAGTATGTTAAAATAAAGGTGCTTAAGGGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP11469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7694-RA 966 CG7694-RA 376..966 1..591 2955 100 Plus
CG7694-RB 640 CG7694-RB 123..640 74..591 2590 100 Plus
fray-RA 3637 fray-RA 389..462 1..74 370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14414257..14414568 74..385 1560 100 Plus
chr3R 27901430 chr3R 14414660..14414867 384..591 1040 100 Plus
chr3R 27901430 chr3R 14397631..14397689 1..59 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18590116..18590427 74..385 1560 100 Plus
3R 32079331 3R 18590519..18590732 384..597 1070 100 Plus
3R 32079331 3R 18573470..18573528 1..59 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18330947..18331258 74..385 1560 100 Plus
3R 31820162 3R 18331350..18331563 384..597 1070 100 Plus
3R 31820162 3R 18314301..18314359 1..59 295 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:39:56 has no hits.

LP11469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:40:55 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14397631..14397686 1..56 100 -> Plus
chr3R 14414238..14414568 57..385 96 -> Plus
chr3R 14414662..14414867 386..591 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:58:34 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RB 1..444 77..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:42 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RB 1..444 77..520 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:11:36 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 1..444 77..520 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:59:34 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RB 1..444 77..520 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:02 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 1..444 77..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:58:34 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 376..966 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:42 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 376..966 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:11:36 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 376..966 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:59:34 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 376..966 1..591 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:02 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
CG7694-RA 380..970 1..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:40:55 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18573470..18573525 1..56 100 -> Plus
3R 18590097..18590427 57..385 96 -> Plus
3R 18590521..18590726 386..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:40:55 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18573470..18573525 1..56 100 -> Plus
3R 18590097..18590427 57..385 96 -> Plus
3R 18590521..18590726 386..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:40:55 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18573470..18573525 1..56 100 -> Plus
3R 18590097..18590427 57..385 96 -> Plus
3R 18590521..18590726 386..591 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:11:36 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14399192..14399247 1..56 100 -> Plus
arm_3R 14415819..14416149 57..385 96 -> Plus
arm_3R 14416243..14416448 386..591 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:04 Download gff for LP11469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18330928..18331258 57..385 96 -> Plus
3R 18331352..18331557 386..591 100   Plus
3R 18314301..18314356 1..56 100 -> Plus

LP11469.hyp Sequence

Translation from 0 to 519

> LP11469.hyp
CEIAFSAIGFSSILQRENSSATTISAMSDYFEELGHEPTGPLGANDLARN
LKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEGGDLECSVCK
EPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPVYEEL
RRFRQDEANRRERENTLLDSMFG*

LP11469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7694-PC 147 CG7694-PC 1..147 27..173 784 100 Plus
CG7694-PB 147 CG7694-PB 1..147 27..173 784 100 Plus
CG7694-PA 147 CG7694-PA 1..147 27..173 784 100 Plus

LP11469.pep Sequence

Translation from 76 to 519

> LP11469.pep
MSDYFEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRA
ILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLW
LKKTNSCPLCRYELETDDPVYEELRRFRQDEANRRERENTLLDSMFG*

LP11469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16908-PA 147 GF16908-PA 1..147 1..147 662 84.4 Plus
Dana\GF11510-PA 628 GF11510-PA 278..347 47..114 146 39.4 Plus
Dana\GF16575-PA 376 GF16575-PA 209..295 30..117 142 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22947-PA 147 GG22947-PA 1..147 1..147 741 94.6 Plus
Dere\GG19861-PA 616 GG19861-PA 278..347 47..114 149 40.8 Plus
Dere\GG14428-PA 381 GG14428-PA 227..300 44..117 147 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18348-PA 147 GH18348-PA 1..147 1..147 615 74.8 Plus
Dgri\GH23135-PA 745 GH23135-PA 280..349 47..114 147 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7694-PC 147 CG7694-PC 1..147 1..147 784 100 Plus
CG7694-PB 147 CG7694-PB 1..147 1..147 784 100 Plus
CG7694-PA 147 CG7694-PA 1..147 1..147 784 100 Plus
gol-PE 461 CG2679-PE 278..347 47..114 144 40.8 Plus
gol-PC 461 CG2679-PC 278..347 47..114 144 40.8 Plus
gol-PB 461 CG2679-PB 278..347 47..114 144 40.8 Plus
gol-PD 601 CG2679-PD 278..347 47..114 144 40.8 Plus
CG11982-PA 380 CG11982-PA 227..300 44..117 143 35.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23331-PA 147 GI23331-PA 1..147 1..147 606 75.5 Plus
Dmoj\GI18477-PA 490 GI18477-PA 279..348 47..114 148 38 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24351-PA 147 GL24351-PA 1..147 1..147 630 76.9 Plus
Dper\GL24353-PA 203 GL24353-PA 1..121 1..124 219 36.8 Plus
Dper\GL16830-PA 737 GL16830-PA 278..347 47..114 151 40.8 Plus
Dper\GL12113-PA 362 GL12113-PA 203..289 30..117 144 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20524-PA 147 GA20524-PA 1..147 1..147 638 77.6 Plus
Dpse\GA26583-PA 318 GA26583-PA 1..121 1..124 225 38.9 Plus
Dpse\GA15425-PC 476 GA15425-PC 273..342 47..114 155 40.8 Plus
Dpse\GA15425-PB 617 GA15425-PB 278..347 47..114 151 40.8 Plus
Dpse\GA11309-PA 362 GA11309-PA 203..289 30..117 144 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17873-PA 163 GM17873-PA 1..141 1..141 698 95 Plus
Dsec\GM11764-PA 611 GM11764-PA 278..347 47..114 150 40.8 Plus
Dsec\GM23778-PA 379 GM23778-PA 227..300 44..117 142 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19234-PA 112 GD19234-PA 1..106 1..106 538 97.2 Plus
Dsim\GD24897-PA 510 GD24897-PA 74..143 47..114 148 40.8 Plus
Dsim\GD18588-PA 379 GD18588-PA 227..300 44..117 142 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10332-PA 114 GJ10332-PA 1..114 34..147 455 71.1 Plus
Dvir\GJ21338-PA 743 GJ21338-PA 278..347 47..114 149 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13091-PA 147 GK13091-PA 1..147 1..147 628 78.9 Plus
Dwil\GK21726-PA 779 GK21726-PA 278..347 47..114 152 40.8 Plus
Dwil\GK11676-PA 362 GK11676-PA 214..288 44..118 144 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11386-PA 616 GE11386-PA 278..347 47..114 149 40.8 Plus
Dyak\GE25922-PA 380 GE25922-PA 227..300 44..117 141 35.1 Plus