BDGP Sequence Production Resources |
Search the DGRC for LP11549
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 115 |
Well: | 49 |
Vector: | pOT2 |
Associated Gene/Transcript | CG1421-RA |
Protein status: | LP11549.pep: gold |
Preliminary Size: | 655 |
Sequenced Size: | 714 |
Gene | Date | Evidence |
---|---|---|
CG1421 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1421 | 2002-05-31 | Blastp of sequenced clone |
CG1421 | 2003-01-01 | Sim4 clustering to Release 3 |
CG1421 | 2008-04-29 | Release 5.5 accounting |
CG1421 | 2008-08-15 | Release 5.9 accounting |
CG1421 | 2008-12-18 | 5.12 accounting |
714 bp (714 high quality bases) assembled on 2002-05-31
GenBank Submission: AY118352
> LP11549.complete GAAAATCGATAAAACAGAGTACGCAGGGATCTTGTTTTCAGGACAACAAA AAGACCATTGCTTACCAACATATCTTGAAGACCCCATAATGGATGGTCTG TCGCGGAAGGCGTTCCATCAAGTCGTTGGAAACAATTCAGACCATACCAT TTTGCAGGATAATAAAAAGAAGTATGGCGAAGATCCCAGACAGTCTTTTT GGGTATCCGTAAGCGACTACGAGTTGGACAGGGCTTACATTGTCTACTGC TTCTTTCTCGATATCGGTGGCATTGTTGCCAAAAGCTTGACGAAAACCAA TCGCATGTACCTGAAGTACTTCAGCGTGGAGGATGCCCGAATCGCGCTGA GCTACGATGGCCAAAAAATTGGATATGGCGGGGATATTCGCGTAAAAGTC ACAGCTGAGAACCCCGTTTCCGAGAATGCCGTCAGTGAATTTCTGGAGCA ATGCTCAGAGGGCAATGGCGATCCCCCTGACAATGAAACTACAGGAATGG CTATTGTCGATGCCGCGGATGAAAGAAACGCGATCATTTCCGATCAACTG CTGATGGGAAACCGTGGAGAAAATAAGTCCAAGGGCACTACCAAAAAAGT CGGTTTTTCCCAGTGGCTTAAAGAAAAACTATCTTATGTGTTCTACTTTT ATTAAATTCCAACATTGCAGCTCTTTTCAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1421-RA | 678 | CG1421-RA | 1..678 | 1..678 | 3390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 21901585..21902262 | 1..678 | 3330 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21903062..21903740 | 1..679 | 3395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21903062..21903740 | 1..679 | 3395 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 21901585..21902262 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..567 | 89..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..567 | 89..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..567 | 89..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..567 | 89..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..567 | 89..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..678 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..678 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 70..747 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 1..678 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1421-RA | 70..747 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21903062..21903739 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21903062..21903739 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21903062..21903739 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 21903062..21903739 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21903062..21903739 | 1..678 | 100 | Plus |
Translation from 0 to 654
> LP11549.hyp KIDKTEYAGILFSGQQKDHCLPTYLEDPIMDGLSRKAFHQVVGNNSDHTI LQDNKKKYGEDPRQSFWVSVSDYELDRAYIVYCFFLDIGGIVAKSLTKTN RMYLKYFSVEDARIALSYDGQKIGYGGDIRVKVTAENPVSENAVSEFLEQ CSEGNGDPPDNETTGMAIVDAADERNAIISDQLLMGNRGENKSKGTTKKV GFSQWLKEKLSYVFYFY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1421-PA | 188 | CG1421-PA | 1..188 | 30..217 | 985 | 100 | Plus |
Translation from 88 to 654
> LP11549.pep MDGLSRKAFHQVVGNNSDHTILQDNKKKYGEDPRQSFWVSVSDYELDRAY IVYCFFLDIGGIVAKSLTKTNRMYLKYFSVEDARIALSYDGQKIGYGGDI RVKVTAENPVSENAVSEFLEQCSEGNGDPPDNETTGMAIVDAADERNAII SDQLLMGNRGENKSKGTTKKVGFSQWLKEKLSYVFYFY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21499-PA | 223 | GF21499-PA | 71..223 | 36..188 | 397 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21348-PA | 220 | GG21348-PA | 33..220 | 1..188 | 715 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17531-PA | 145 | GH17531-PA | 8..145 | 38..187 | 277 | 43.3 | Plus |
Dgri\GH10449-PA | 145 | GH10449-PA | 8..145 | 38..187 | 276 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1421-PA | 188 | CG1421-PA | 1..188 | 1..188 | 985 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17701-PA | 207 | GI17701-PA | 63..204 | 37..187 | 285 | 41.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25658-PA | 249 | GL25658-PA | 70..249 | 37..188 | 306 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12824-PA | 252 | GA12824-PA | 69..252 | 37..188 | 297 | 38.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16147-PA | 188 | GM16147-PA | 1..188 | 1..188 | 907 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24336-PA | 188 | GD24336-PA | 1..188 | 1..188 | 907 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11387-PA | 295 | GJ11387-PA | 70..180 | 36..141 | 297 | 53.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12929-PA | 215 | GE12929-PA | 28..215 | 1..188 | 695 | 70.9 | Plus |