Clone LP11549 Report

Search the DGRC for LP11549

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:115
Well:49
Vector:pOT2
Associated Gene/TranscriptCG1421-RA
Protein status:LP11549.pep: gold
Preliminary Size:655
Sequenced Size:714

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1421 2002-01-01 Sim4 clustering to Release 2
CG1421 2002-05-31 Blastp of sequenced clone
CG1421 2003-01-01 Sim4 clustering to Release 3
CG1421 2008-04-29 Release 5.5 accounting
CG1421 2008-08-15 Release 5.9 accounting
CG1421 2008-12-18 5.12 accounting

Clone Sequence Records

LP11549.complete Sequence

714 bp (714 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118352

> LP11549.complete
GAAAATCGATAAAACAGAGTACGCAGGGATCTTGTTTTCAGGACAACAAA
AAGACCATTGCTTACCAACATATCTTGAAGACCCCATAATGGATGGTCTG
TCGCGGAAGGCGTTCCATCAAGTCGTTGGAAACAATTCAGACCATACCAT
TTTGCAGGATAATAAAAAGAAGTATGGCGAAGATCCCAGACAGTCTTTTT
GGGTATCCGTAAGCGACTACGAGTTGGACAGGGCTTACATTGTCTACTGC
TTCTTTCTCGATATCGGTGGCATTGTTGCCAAAAGCTTGACGAAAACCAA
TCGCATGTACCTGAAGTACTTCAGCGTGGAGGATGCCCGAATCGCGCTGA
GCTACGATGGCCAAAAAATTGGATATGGCGGGGATATTCGCGTAAAAGTC
ACAGCTGAGAACCCCGTTTCCGAGAATGCCGTCAGTGAATTTCTGGAGCA
ATGCTCAGAGGGCAATGGCGATCCCCCTGACAATGAAACTACAGGAATGG
CTATTGTCGATGCCGCGGATGAAAGAAACGCGATCATTTCCGATCAACTG
CTGATGGGAAACCGTGGAGAAAATAAGTCCAAGGGCACTACCAAAAAAGT
CGGTTTTTCCCAGTGGCTTAAAGAAAAACTATCTTATGTGTTCTACTTTT
ATTAAATTCCAACATTGCAGCTCTTTTCAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

LP11549.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG1421-RA 678 CG1421-RA 1..678 1..678 3390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21901585..21902262 1..678 3330 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21903062..21903740 1..679 3395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21903062..21903740 1..679 3395 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:00:05 has no hits.

LP11549.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:00:47 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21901585..21902262 1..678 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:30 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..567 89..655 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:53 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..567 89..655 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:42 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..567 89..655 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:23 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..567 89..655 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:17 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..567 89..655 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:04:50 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..678 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:53 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..678 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:42 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 70..747 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:24 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 1..678 1..678 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:17 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
CG1421-RA 70..747 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:47 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21903062..21903739 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:47 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21903062..21903739 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:47 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21903062..21903739 1..678 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:42 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21903062..21903739 1..678 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:52 Download gff for LP11549.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21903062..21903739 1..678 100   Plus

LP11549.hyp Sequence

Translation from 0 to 654

> LP11549.hyp
KIDKTEYAGILFSGQQKDHCLPTYLEDPIMDGLSRKAFHQVVGNNSDHTI
LQDNKKKYGEDPRQSFWVSVSDYELDRAYIVYCFFLDIGGIVAKSLTKTN
RMYLKYFSVEDARIALSYDGQKIGYGGDIRVKVTAENPVSENAVSEFLEQ
CSEGNGDPPDNETTGMAIVDAADERNAIISDQLLMGNRGENKSKGTTKKV
GFSQWLKEKLSYVFYFY*

LP11549.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1421-PA 188 CG1421-PA 1..188 30..217 985 100 Plus

LP11549.pep Sequence

Translation from 88 to 654

> LP11549.pep
MDGLSRKAFHQVVGNNSDHTILQDNKKKYGEDPRQSFWVSVSDYELDRAY
IVYCFFLDIGGIVAKSLTKTNRMYLKYFSVEDARIALSYDGQKIGYGGDI
RVKVTAENPVSENAVSEFLEQCSEGNGDPPDNETTGMAIVDAADERNAII
SDQLLMGNRGENKSKGTTKKVGFSQWLKEKLSYVFYFY*

LP11549.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21499-PA 223 GF21499-PA 71..223 36..188 397 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21348-PA 220 GG21348-PA 33..220 1..188 715 72.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17531-PA 145 GH17531-PA 8..145 38..187 277 43.3 Plus
Dgri\GH10449-PA 145 GH10449-PA 8..145 38..187 276 42.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG1421-PA 188 CG1421-PA 1..188 1..188 985 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17701-PA 207 GI17701-PA 63..204 37..187 285 41.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25658-PA 249 GL25658-PA 70..249 37..188 306 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12824-PA 252 GA12824-PA 69..252 37..188 297 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16147-PA 188 GM16147-PA 1..188 1..188 907 88.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24336-PA 188 GD24336-PA 1..188 1..188 907 88.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11387-PA 295 GJ11387-PA 70..180 36..141 297 53.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12929-PA 215 GE12929-PA 28..215 1..188 695 70.9 Plus