Clone LP11709 Report

Search the DGRC for LP11709

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:117
Well:9
Vector:pOT2
Associated Gene/TranscriptCG13364-RA
Protein status:LP11709.pep: gold
Sequenced Size:372

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13364 2003-01-01 Sim4 clustering to Release 3
CG13364 2004-01-31 Blastp of sequenced clone
CG13364 2008-04-29 Release 5.5 accounting

Clone Sequence Records

LP11709.complete Sequence

372 bp (372 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011542

> LP11709.complete
CAAGTATGTCTGGACGCGAGGGCGGTAAGAAGAAGCCTCTGAAGGCGCCG
AAGAAGGACTCCAAAGACCTGGACGAGGACGACATGGCCTTCAAGCAAAA
GCAGAAGGAGCAGCAGAAGGCTCTGGAGGCGGCCAAGGCGAACGCCTCAA
AGAAGGGTCCTCTCGTAGGAGGCGGCATCAAGAAGTCGGGAAAGAAGTGA
AGCTGCCACGCCTCCATCTGTAGTCCGCAACCCACTGGATTCTGGACGCT
GAATTGCCAGCCGAAGCACACCCATGTGGACCATAATCTTTTTATACTTA
CGATTACCATTAAATAGATCATTGTACGTCAGGATAGAGAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

LP11709.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 541 CG13364-RA 148..487 1..340 1700 100 Plus
CG16824-RA 407 CG16824-RA 71..289 6..222 575 84.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 518750..519088 339..1 1695 100 Minus
chr2L 23010047 chr2L 13291748..13291942 6..200 570 86.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624756..625095 340..1 1700 100 Minus
2L 23513712 2L 13293079..13293273 6..200 570 86.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 632854..633193 340..1 1700 100 Minus
2L 23513712 2L 13293079..13293297 6..222 575 84.9 Plus
Blast to na_te.dros performed on 2019-03-16 22:11:55 has no hits.

LP11709.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:12:39 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 518750..519088 1..339 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:37 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 6..200 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:41 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 6..200 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:12:57 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 6..200 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:31 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 6..200 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:20 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 6..200 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:44 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..384 1..338 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:41 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..384 1..338 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:12:57 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 49..387 1..339 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:32 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..384 1..338 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:20 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 49..387 1..339 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:39 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
X 624757..625095 1..339 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:39 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
X 624757..625095 1..339 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:12:39 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
X 624757..625095 1..339 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:12:57 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 518790..519128 1..339 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:57 Download gff for LP11709.complete
Subject Subject Range Query Range Percent Splice Strand
X 632855..633193 1..339 100   Minus

LP11709.hyp Sequence

Translation from 2 to 199

> LP11709.hyp
SMSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASK
KGPLVGGGIKKSGKK*

LP11709.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 64 CG13364-PA 1..64 2..65 324 100 Plus
CG16824-PA 64 CG16824-PA 1..64 2..65 301 90.6 Plus

LP11709.pep Sequence

Translation from 5 to 199

> LP11709.pep
MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKK
GPLVGGGIKKSGKK*

LP11709.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22061-PA 64 GF22061-PA 1..54 1..54 186 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12752-PA 64 GG12752-PA 1..64 1..64 296 100 Plus
Dere\GG23837-PA 64 GG23837-PA 1..54 1..54 143 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12614-PA 64 GH12614-PA 1..54 1..54 126 87 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 64 CG13364-PA 1..64 1..64 324 100 Plus
CG16824-PA 64 CG16824-PA 1..64 1..64 301 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14435-PA 64 GL14435-PA 1..54 1..54 130 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22264-PA 64 GA22264-PA 1..54 1..54 130 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19032-PA 64 GM19032-PA 1..64 1..64 296 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16470-PA 38 GD16470-PA 1..28 27..54 125 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25327-PA 64 GK25327-PA 1..64 1..64 289 96.9 Plus
Dwil\GK21753-PA 64 GK21753-PA 1..54 1..54 157 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16577-PA 64 GE16577-PA 1..64 1..64 290 96.9 Plus
Dyak\GE18641-PA 64 GE18641-PA 1..54 1..54 143 94.4 Plus