Clone LP11958 Report

Search the DGRC for LP11958

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:119
Well:58
Vector:pOT2
Associated Gene/TranscriptCREG-RC
Protein status:LP11958.pep: gold
Sequenced Size:810

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5413 2002-10-31 Blastp of sequenced clone
CG5413 2003-01-01 Sim4 clustering to Release 3
CREG 2008-04-29 Release 5.5 accounting
CREG 2008-08-15 Release 5.9 accounting
CREG 2008-12-18 5.12 accounting

Clone Sequence Records

LP11958.complete Sequence

810 bp (810 high quality bases) assembled on 2002-10-31

GenBank Submission: BT001520

> LP11958.complete
TTGCAGTCTAGCCATGAAAACCTTTCACTCCCTACTATTCGCCCTGATTT
TGGCCCTCGTGAGCCTGGACCCCTCTTCCGGTTACTCCCGCCGGAAAGAT
GAGCGTATAATTAGAGAATATAAGCGAGAGCAAGAGTTAAATCACGCCAA
GATCGCCAGAGATTTGGTCCATCGCGCCAATTGGGCGGCTGTGGGAAGTC
TCTCCACCAACGAACGGGTGAAGGGGTATCCCATGGTCAACATTATCTCC
ATCGACGACAGCGATGCTAATAACAGGTCCACTGGACGTATTCGATTCCT
GCTAACCGATTTGGACTTCACTGGTCCCGACTGGCAGAAGGACAACAAGG
TCACACTCCTGTTCAGTGACGAGCAGACCCTAAGATGCAAGGAGGGCGGA
AAGGATCCCATGGAGCCTACATGTGCCCGTTCCATGATCAGTGGACAGGT
GAAGAAGCTCACAATTTCTACCTTTGCGAACTGGAAATTAGCAATATCTT
TGTTCTGGACTTCTATGGAGGTCCTCATAAAGTGAGCGCCTCTGACTATT
ACGCTGTTTCGAATTGATGAACTCCTCCAAAAGCAATCCAACTGACGCCT
CATATACTTTGTCAAAAAATGAAATGATAAGCATATTTGCACAACATGTC
TGCCACAAAGGGAAAGAATGAAGACAAAGGCCTTTATGAAAGCCACTTAT
CAGTTGAGCTCTGTGATTTCAATCGATAGAACAATAACTTTGATATAAAT
AAAAATACATTCCGTTGAATGTACTCTGACATACTGAAAAAAAAAAAAAA
AAAAAAAAAA

LP11958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-RC 929 CREG-RC 98..886 1..789 3945 100 Plus
CREG-RA 1041 CREG-RA 128..584 1..457 2285 100 Plus
CREG-RB 1154 CREG-RB 248..701 4..457 2270 100 Plus
CREG-RA 1041 CREG-RA 664..998 455..789 1675 100 Plus
CREG-RB 1154 CREG-RB 781..1115 455..789 1675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13218188..13218644 457..1 2225 99.1 Minus
chr3R 27901430 chr3R 13217645..13217974 786..456 1545 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17393816..17394272 457..1 2285 100 Minus
3R 32079331 3R 17393269..17393602 789..456 1670 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17134647..17135103 457..1 2285 100 Minus
3R 31820162 3R 17134100..17134433 789..456 1670 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:38:30 has no hits.

LP11958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:22 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13217645..13217972 458..786 98 <- Minus
chr3R 13218188..13218644 1..457 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:45 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 1..522 14..535 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:43 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 1..522 14..535 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:46 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 1..522 14..535 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:59:37 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 1..522 14..535 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:10 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 1..522 14..535 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:18 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 11..796 1..786 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:43 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 11..796 1..786 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:46 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 38..823 1..786 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:59:38 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 11..796 1..786 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:10 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
CREG-RC 38..823 1..786 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:22 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393272..17393600 458..786 100 <- Minus
3R 17393816..17394272 1..457 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:22 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393272..17393600 458..786 100 <- Minus
3R 17393816..17394272 1..457 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:22 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17393272..17393600 458..786 100 <- Minus
3R 17393816..17394272 1..457 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:46 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13218994..13219322 458..786 100 <- Minus
arm_3R 13219538..13219994 1..457 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:06 Download gff for LP11958.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17134103..17134431 458..786 100 <- Minus
3R 17134647..17135103 1..457 100   Minus

LP11958.hyp Sequence

Translation from 0 to 534

> LP11958.hyp
CSLAMKTFHSLLFALILALVSLDPSSGYSRRKDERIIREYKREQELNHAK
IARDLVHRANWAAVGSLSTNERVKGYPMVNIISIDDSDANNRSTGRIRFL
LTDLDFTGPDWQKDNKVTLLFSDEQTLRCKEGGKDPMEPTCARSMISGQV
KKLTISTFANWKLAISLFWTSMEVLIK*

LP11958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-PC 173 CG5413-PC 1..173 5..177 891 100 Plus
CREG-PD 211 CG5413-PD 1..149 5..153 766 99.3 Plus
CREG-PB 211 CG5413-PB 1..149 5..153 766 99.3 Plus
CREG-PA 211 CG5413-PA 1..149 5..153 766 99.3 Plus

LP11958.pep Sequence

Translation from 13 to 534

> LP11958.pep
MKTFHSLLFALILALVSLDPSSGYSRRKDERIIREYKREQELNHAKIARD
LVHRANWAAVGSLSTNERVKGYPMVNIISIDDSDANNRSTGRIRFLLTDL
DFTGPDWQKDNKVTLLFSDEQTLRCKEGGKDPMEPTCARSMISGQVKKLT
ISTFANWKLAISLFWTSMEVLIK*

LP11958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16884-PA 211 GF16884-PA 7..150 7..150 602 75.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16779-PA 211 GG16779-PA 1..152 1..152 650 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17497-PA 212 GH17497-PA 10..150 7..149 512 67.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
CREG-PC 173 CG5413-PC 1..173 1..173 891 100 Plus
CREG-PD 211 CG5413-PD 1..149 1..149 766 99.3 Plus
CREG-PB 211 CG5413-PB 1..149 1..149 766 99.3 Plus
CREG-PA 211 CG5413-PA 1..149 1..149 766 99.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22825-PA 207 GI22825-PA 3..145 7..149 530 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23943-PA 211 GL23943-PA 21..149 21..149 561 78.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18865-PA 211 GA18865-PA 1..149 1..149 589 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15369-PA 211 GM15369-PA 1..152 1..152 698 90.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20237-PA 211 GD20237-PA 1..152 1..152 699 93.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22827-PA 211 GJ22827-PA 8..149 8..149 540 70.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11455-PA 215 GK11455-PA 14..167 11..164 560 66.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24171-PA 211 GE24171-PA 23..152 23..152 657 92.3 Plus