Clone LP12049 Report

Search the DGRC for LP12049

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:120
Well:49
Vector:pOT2
Associated Gene/TranscriptCG5506-RA
Protein status:LP12049.pep: gold
Preliminary Size:638
Sequenced Size:657

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5506 2002-01-01 Sim4 clustering to Release 2
CG5506 2002-05-18 Blastp of sequenced clone
CG5506 2003-01-01 Sim4 clustering to Release 3
CG5506 2008-04-29 Release 5.5 accounting
CG5506 2008-08-15 Release 5.9 accounting
CG5506 2008-12-18 5.12 accounting

Clone Sequence Records

LP12049.complete Sequence

657 bp (657 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119093

> LP12049.complete
TCCGTCAAGATGTACAAACTTGTCTGTGTAGTTTTGGCCCTGTTTGCAGT
TGCCTACGCGGTTCCCTCGACTTATGATACCGAGCACGTGTGGAAGGCTG
GTAACCTGTCCTACGTTATTCCCTATAATGCCGTTGTGGGTGGCTTCGAT
CCCTACGGATTTACCACCTATGTTGGTCGTGTTAAGTACTCCAATAGCAT
CCTGCCGGCTCGAGTTGTTGCGGAAACTGGTACTGCTTACTTCAATACGG
AAACCACATCCTCGAAGCTCCTCGTCTACGACATCCTAGTGGCTGAGCGG
GATGTAAATTACGTGTGGGTCAGGAGCTTCGATGGATTCTATGAAAAGGG
AGCCGTTGCCGTGGGCACGACGGTCAAAAATGAGCGGGTGTTCTGCTGCC
GTGCTAAGACCGATGGAGGCATCCTAATCGGCACCCTGCTCCTTAGCAGC
CAGAAGGTGTGCATCATCAAGCACGAGAGCTTGGCCCTGCGAAAGTTCGA
CAAATATGAAGTTCTGGTGGCCCAGCCTAAAGGCAATGGAACATACTACT
AAATTCTACTACTAGATCTTTGTCTGAATTAAGTTCCTTTGATATCCCGG
CTCCCTTAAAAAATAAATAAAACATAATTTATTTCAAGTAAAAAAAAAAA
AAAAAAA

LP12049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5506-RA 811 CG5506-RA 122..762 1..641 3205 100 Plus
CG5506.a 672 CG5506.a 109..672 76..639 2820 100 Plus
CG5506.a 672 CG5506.a 21..96 1..76 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17873266..17873829 639..76 2820 100 Minus
chr3L 24539361 chr3L 17873896..17873971 76..1 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17883647..17884212 641..76 2830 100 Minus
3L 28110227 3L 17884279..17884354 76..1 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17876747..17877312 641..76 2830 100 Minus
3L 28103327 3L 17877379..17877454 76..1 380 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:51:33 has no hits.

LP12049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:52:42 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17873266..17873828 77..639 100 <- Minus
chr3L 17873896..17873971 1..76 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:49 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 1..543 10..552 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:34 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 1..543 10..552 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:21 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 1..543 10..552 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:58 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 1..543 10..552 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:59 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 1..543 10..552 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:00:59 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 21..659 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:34 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 21..659 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:21 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 23..661 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:58 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 7..645 1..639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:59 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5506-RA 23..661 1..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:42 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17883649..17884211 77..639 100 <- Minus
3L 17884279..17884354 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:42 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17883649..17884211 77..639 100 <- Minus
3L 17884279..17884354 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:42 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17883649..17884211 77..639 100 <- Minus
3L 17884279..17884354 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:21 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17876749..17877311 77..639 100 <- Minus
arm_3L 17877379..17877454 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:20 Download gff for LP12049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17876749..17877311 77..639 100 <- Minus
3L 17877379..17877454 1..76 100   Minus

LP12049.hyp Sequence

Translation from 0 to 551

> LP12049.hyp
SVKMYKLVCVVLALFAVAYAVPSTYDTEHVWKAGNLSYVIPYNAVVGGFD
PYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDILVAER
DVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSS
QKVCIIKHESLALRKFDKYEVLVAQPKGNGTYY*

LP12049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5506-PA 180 CG5506-PA 1..180 4..183 938 100 Plus
CG16775-PB 191 CG16775-PB 3..175 1..175 405 48 Plus
CG32633-PB 285 CG32633-PB 14..145 40..177 165 35.5 Plus
CG32633-PA 285 CG32633-PA 14..145 40..177 165 35.5 Plus
CG31086-PB 148 CG31086-PB 14..141 40..172 155 33.1 Plus

LP12049.pep Sequence

Translation from 9 to 551

> LP12049.pep
MYKLVCVVLALFAVAYAVPSTYDTEHVWKAGNLSYVIPYNAVVGGFDPYG
FTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDILVAERDVN
YVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSSQKV
CIIKHESLALRKFDKYEVLVAQPKGNGTYY*

LP12049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25229-PA 179 GF25229-PA 1..179 1..180 728 76.1 Plus
Dana\GF25228-PA 179 GF25228-PA 1..179 1..180 692 73.3 Plus
Dana\GF25227-PA 186 GF25227-PA 9..177 5..174 411 47.1 Plus
Dana\GF22376-PA 285 GF22376-PA 2..145 24..174 177 33.1 Plus
Dana\GF16764-PA 148 GF16764-PA 3..141 25..169 167 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15771-PA 180 GG15771-PA 1..180 1..180 916 96.1 Plus
Dere\GG15770-PA 191 GG15770-PA 26..175 22..172 407 49.7 Plus
Dere\GG17790-PA 285 GG17790-PA 14..145 37..174 179 35.5 Plus
Dere\GG11468-PA 148 GG11468-PA 14..144 37..161 171 32.1 Plus
Dere\GG20349-PA 286 GG20349-PA 3..146 25..174 149 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10742-PA 189 GH10742-PA 26..177 22..174 409 51 Plus
Dgri\GH10743-PA 189 GH10743-PA 26..177 22..174 408 51.6 Plus
Dgri\GH10740-PA 189 GH10740-PA 26..177 22..174 403 52.9 Plus
Dgri\GH10744-PA 189 GH10744-PA 26..177 22..174 383 47.7 Plus
Dgri\GH10741-PA 189 GH10741-PA 26..177 22..174 378 47.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5506-PA 180 CG5506-PA 1..180 1..180 938 100 Plus
CG16775-PB 191 CG16775-PB 9..175 4..172 400 48.5 Plus
CG32633-PB 285 CG32633-PB 14..145 37..174 165 35.5 Plus
CG32633-PA 285 CG32633-PA 14..145 37..174 165 35.5 Plus
CG31086-PB 148 CG31086-PB 14..141 37..169 155 33.1 Plus
CG31086-PA 148 CG31086-PA 14..141 37..169 155 33.1 Plus
CG44251-PA 478 CG44251-PA 5..144 28..172 146 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11540-PA 181 GI11540-PA 1..178 1..178 572 60.9 Plus
Dmoj\GI17512-PA 186 GI17512-PA 5..175 9..172 427 50.6 Plus
Dmoj\GI17507-PA 189 GI17507-PA 1..175 1..172 425 48.9 Plus
Dmoj\GI11542-PA 189 GI11542-PA 1..175 1..172 425 48.9 Plus
Dmoj\GI10797-PA 189 GI10797-PA 8..184 4..179 401 44.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22740-PA 178 GL22740-PA 1..178 1..180 684 73.3 Plus
Dper\GL22739-PA 177 GL22739-PA 33..161 45..174 325 50 Plus
Dper\GL22738-PA 173 GL22738-PA 10..154 4..150 286 40.8 Plus
Dper\GL21834-PA 148 GL21834-PA 14..141 37..169 176 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18935-PA 178 GA18935-PA 1..178 1..180 684 73.3 Plus
Dpse\GA14139-PA 193 GA14139-PA 26..175 22..172 354 47.7 Plus
Dpse\GA23404-PA 186 GA23404-PA 25..178 21..175 323 45.8 Plus
Dpse\GA15997-PA 148 GA15997-PA 14..141 37..169 174 34.6 Plus
Dpse\GA17750-PA 287 GA17750-PA 2..144 25..172 143 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24296-PA 180 GM24296-PA 1..180 1..180 882 92.8 Plus
Dsec\GM24294-PA 191 GM24294-PA 26..177 22..174 401 49 Plus
Dsec\GM24295-PA 186 GM24295-PA 26..177 22..174 378 47.7 Plus
Dsec\GM17616-PA 285 GM17616-PA 14..145 37..174 174 34.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12365-PA 180 GD12365-PA 1..180 1..180 903 95 Plus
Dsim\GD12364-PA 186 GD12364-PA 24..177 20..174 391 49 Plus
Dsim\GD24809-PA 285 GD24809-PA 14..145 37..174 175 35.5 Plus
Dsim\GD21274-PA 148 GD21274-PA 13..141 36..169 165 32.8 Plus
Dsim\GD25797-PA 642 GD25797-PA 284..414 37..172 148 27.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11559-PA 180 GJ11559-PA 1..180 1..180 574 60.8 Plus
Dvir\GJ12837-PA 189 GJ12837-PA 26..175 22..172 444 57 Plus
Dvir\GJ15279-PA 179 GJ15279-PA 16..165 22..172 427 55 Plus
Dvir\GJ12751-PA 189 GJ12751-PA 26..175 22..172 422 53 Plus
Dvir\GJ12817-PA 187 GJ12817-PA 24..173 22..172 418 53.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20578-PA 172 GK20578-PA 3..172 2..172 582 64.9 Plus
Dwil\GK20577-PA 191 GK20577-PA 8..177 7..174 382 47.4 Plus
Dwil\GK16750-PA 178 GK16750-PA 1..177 1..175 341 44.4 Plus
Dwil\GK16755-PA 177 GK16755-PA 1..126 1..120 263 49.6 Plus
Dwil\GK13296-PA 148 GK13296-PA 2..141 24..169 183 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22104-PA 180 GE22104-PA 1..180 1..180 891 93.3 Plus
Dyak\GE22103-PA 191 GE22103-PA 26..175 22..172 406 50.3 Plus
Dyak\GE17086-PA 285 GE17086-PA 2..145 24..174 172 33.8 Plus
Dyak\GE23659-PA 148 GE23659-PA 13..141 36..169 167 32.8 Plus
Dyak\GE13407-PA 477 GE13407-PA 6..145 28..172 150 26.9 Plus