Clone LP12095 Report

Search the DGRC for LP12095

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:120
Well:95
Vector:pOT2
Associated Gene/TranscriptPebp1-RA
Protein status:LP12095.pep: gold
Preliminary Size:598
Sequenced Size:608

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18594 2002-01-01 Sim4 clustering to Release 2
CG18594 2002-05-18 Blastp of sequenced clone
CG18594 2003-01-01 Sim4 clustering to Release 3
CG18594 2008-04-29 Release 5.5 accounting
CG18594 2008-08-15 Release 5.9 accounting
CG18594 2008-12-18 5.12 accounting

Clone Sequence Records

LP12095.complete Sequence

608 bp (608 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119094

> LP12095.complete
ATGGACACCGCCGGCATTATTCCCGACATCATCGACGTCAAGCCCGCCTC
CAAGGCCACCATCACCTATCCTTCCGGCGTTCAGGTTGAGCTGGGCAAGG
AGCTGACTCCCACTCAGGTGAAGGACCAGCCCACTGTCGTCTTCGATGCC
GAGCCCAACTCCCTGTACACCATCCTGTTGGTGGACCCCGACGCACCCAG
CCGCGAGGACCCCAAGTTCCGTGAGCTGCTCCACTGGCTGGTGATCAACA
TTCCCGGCAACAAGGTGTCCGAGGGCCAGACCATCGCCGAGTACATCGGT
GCTGGACCCCGCGAGGGAACCGGCCTGCACCGCTACGTCTTCCTGGTGTT
CAAGCAGAACGACAAGATCACCACCGAGAAGTTCGTGTCCAAGACCAGCC
GCACTGGCCGCATCAACGTCAAGGCCCGCGACTACATCCAGAAGTACAGC
TTCGGCGGTCCCGTGGCCGGCAACTTCTTCCAGGCCCAATACGATGACTA
CGTGAAGACCCTCATCGAGACGGTCCAGTAATCTGGCCACCAACTGATCA
GCTCTCTGTGAAATAATAAATATTAAATATGTACTAGTTAAAAAAAAAAA
AAAAAAAA

LP12095.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18594-RA 644 CG18594-RA 56..644 1..589 2945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18289627..18290215 1..589 2915 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22466091..22466679 1..589 2945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22206922..22207510 1..589 2945 100 Plus
3R 31820162 3R 6085582..6085658 281..357 175 81.8 Plus
3R 31820162 3R 6084170..6084235 196..261 165 83.3 Plus
Blast to na_te.dros performed on 2019-03-16 04:38:35 has no hits.

LP12095.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:25 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18289627..18290215 1..589 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:50 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:30 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:50 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
Pebp1-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:30 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:20 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
Pebp1-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:19 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 1..589 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:30 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 56..644 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:50 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
Pebp1-RA 58..646 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:31 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
CG18594-RA 1..589 1..589 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:20 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
Pebp1-RA 58..646 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:25 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22466091..22466679 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:25 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22466091..22466679 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:25 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22466091..22466679 1..589 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:50 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18291813..18292401 1..589 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:23 Download gff for LP12095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22206922..22207510 1..589 100   Plus

LP12095.pep Sequence

Translation from 0 to 530

> LP12095.pep
MDTAGIIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDA
EPNSLYTILLVDPDAPSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIG
AGPREGTGLHRYVFLVFKQNDKITTEKFVSKTSRTGRINVKARDYIQKYS
FGGPVAGNFFQAQYDDYVKTLIETVQ*

LP12095.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23379-PA 176 GF23379-PA 1..176 1..176 844 90.9 Plus
Dana\GF16395-PA 186 GF16395-PA 13..183 6..175 551 57.9 Plus
Dana\GF23378-PA 175 GF23378-PA 4..174 6..172 480 51.7 Plus
Dana\GF14208-PA 260 GF14208-PA 83..254 1..171 477 50 Plus
Dana\GF16396-PA 202 GF16396-PA 28..195 5..171 473 50.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11139-PA 176 GG11139-PA 1..176 1..176 922 100 Plus
Dere\GG13336-PA 187 GG13336-PA 13..183 6..175 514 55 Plus
Dere\GG11138-PA 179 GG11138-PA 4..170 6..168 493 53.3 Plus
Dere\GG23796-PA 178 GG23796-PA 1..176 1..175 477 49.4 Plus
Dere\GG13347-PA 202 GG13347-PA 29..195 6..171 470 51.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22236-PA 176 GH22236-PA 1..171 1..171 703 74.3 Plus
Dgri\GH14039-PA 186 GH14039-PA 13..183 6..175 509 53.8 Plus
Dgri\GH22229-PA 177 GH22229-PA 4..168 6..168 504 54.5 Plus
Dgri\GH13213-PA 178 GH13213-PA 1..176 1..175 462 48.3 Plus
Dgri\GH14040-PA 202 GH14040-PA 28..195 5..171 431 46.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Pebp1-PA 176 CG18594-PA 1..176 1..176 912 100 Plus
CG10298-PA 187 CG10298-PA 13..179 6..171 525 58.7 Plus
CG7054-PA 179 CG7054-PA 4..177 6..175 477 49.4 Plus
CG6180-PA 257 CG6180-PA 80..251 1..171 469 50 Plus
CG17919-PA 202 CG17919-PA 29..195 6..171 465 51.5 Plus
a5-PA 210 CG5430-PA 35..205 6..175 406 42.7 Plus
CG17917-PA 211 CG17917-PA 26..201 1..175 372 41.8 Plus
CG30060-PA 202 CG30060-PA 23..179 6..164 236 31.9 Plus
mRpL38-PA 416 CG15871-PA 165..311 32..166 159 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21978-PA 177 GI21978-PA 1..171 1..171 715 74.9 Plus
Dmoj\GI21977-PA 179 GI21977-PA 3..170 5..168 494 52.4 Plus
Dmoj\GI24413-PA 183 GI24413-PA 10..180 6..175 489 50.9 Plus
Dmoj\GI14504-PA 178 GI14504-PA 1..176 1..175 466 50 Plus
Dmoj\GI24414-PA 202 GI24414-PA 28..195 5..171 439 48.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24221-PA 739 GL24221-PA 1..143 1..142 623 80.4 Plus
Dper\GL24078-PA 189 GL24078-PA 15..185 6..175 505 54.4 Plus
Dper\GL24219-PA 179 GL24219-PA 4..170 6..168 483 52.1 Plus
Dper\GL24079-PA 203 GL24079-PA 30..196 6..171 480 53.9 Plus
Dper\GL19726-PA 256 GL19726-PA 79..254 1..175 470 48.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15006-PA 176 GA15006-PA 1..176 1..176 781 80.7 Plus
Dpse\GA10227-PA 189 GA10227-PA 15..185 6..175 509 55 Plus
Dpse\GA20063-PA 179 GA20063-PA 4..170 6..168 481 52.1 Plus
Dpse\GA14724-PA 203 GA14724-PA 30..196 6..171 479 53.9 Plus
Dpse\GA19416-PA 256 GA19416-PA 79..254 1..175 470 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26437-PA 176 GM26437-PA 1..176 1..176 919 99.4 Plus
Dsec\GM10886-PA 187 GM10886-PA 13..183 6..175 505 56.1 Plus
Dsec\GM26436-PA 179 GM26436-PA 4..177 6..175 482 50 Plus
Dsec\GM10048-PA 178 GM10048-PA 1..176 1..175 475 48.9 Plus
Dsec\GM10887-PA 202 GM10887-PA 29..195 6..171 463 51.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20954-PA 176 GD20954-PA 1..176 1..176 922 100 Plus
Dsim\GD19865-PA 187 GD19865-PA 13..183 6..175 508 56.1 Plus
Dsim\GD20953-PA 179 GD20953-PA 4..170 6..168 481 51.5 Plus
Dsim\GD23851-PA 178 GD23851-PA 1..176 1..175 475 48.9 Plus
Dsim\GD19866-PA 202 GD19866-PA 29..195 6..171 462 50.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14338-PA 176 GJ14338-PA 1..171 1..171 717 74.3 Plus
Dvir\GJ14337-PA 179 GJ14337-PA 4..170 6..168 503 51.5 Plus
Dvir\GJ14271-PA 186 GJ14271-PA 13..183 6..175 480 49.7 Plus
Dvir\GJ16279-PA 226 GJ16279-PA 49..220 1..171 477 50 Plus
Dvir\GJ14272-PA 200 GJ14272-PA 28..194 6..171 439 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11698-PA 176 GK11698-PA 1..176 1..176 779 80.7 Plus
Dwil\GK11701-PA 180 GK11701-PA 1..176 1..176 715 73.3 Plus
Dwil\GK11699-PA 174 GK11699-PA 1..169 1..171 710 76 Plus
Dwil\GK11700-PA 172 GK11700-PA 5..167 9..171 584 66.9 Plus
Dwil\GK13055-PA 191 GK13055-PA 16..183 5..171 501 56.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10305-PA 176 GE10305-PA 1..176 1..176 915 98.9 Plus
Dyak\GE10210-PA 187 GE10210-PA 13..183 6..175 521 55.6 Plus
Dyak\GE10304-PA 179 GE10304-PA 4..177 6..175 486 50.6 Plus
Dyak\GE18600-PA 178 GE18600-PA 1..176 1..175 471 48.9 Plus
Dyak\GE10211-PA 202 GE10211-PA 29..195 6..171 463 51.5 Plus

LP12095.hyp Sequence

Translation from 1 to 530

> LP12095.hyp
MDTAGIIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDA
EPNSLYTILLVDPDAPSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIG
AGPREGTGLHRYVFLVFKQNDKITTEKFVSKTSRTGRINVKARDYIQKYS
FGGPVAGNFFQAQYDDYVKTLIETVQ*

LP12095.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Pebp1-PA 176 CG18594-PA 1..176 1..176 912 100 Plus
CG10298-PA 187 CG10298-PA 13..179 6..171 525 58.7 Plus
CG7054-PA 179 CG7054-PA 4..177 6..175 477 49.4 Plus
CG6180-PA 257 CG6180-PA 80..251 1..171 469 50 Plus
CG17919-PA 202 CG17919-PA 29..195 6..171 465 51.5 Plus