Clone LP12385 Report

Search the DGRC for LP12385

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:85
Vector:pOT2
Associated Gene/TranscriptCpr12A-RA
Protein status:LP12385.pep: gold
Preliminary Size:654
Sequenced Size:876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15757 2002-01-01 Sim4 clustering to Release 2
CG15757 2002-05-18 Blastp of sequenced clone
CG15757 2003-01-01 Sim4 clustering to Release 3
Cpr12A 2008-04-29 Release 5.5 accounting
Cpr12A 2008-08-15 Release 5.9 accounting
Cpr12A 2008-12-18 5.12 accounting

Clone Sequence Records

LP12385.complete Sequence

876 bp (876 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119097

> LP12385.complete
AAACATCGCGCGACAGCACACACACCATCCACCTGCGTAGCCCAAACATC
CCACACATCCATCCCACCACCACCCATAAATCACATTACATCCACATATC
CACACACACATTCACACCGATCCGAGTTAAAATGGCCACTTCCGGTTCGA
TCCTGTTCGCCATCTTCCTGCTGAGCGCCACCCTCATTTCCGCCCAGCAG
ATCAAAGAGTCGGCGCCCAGTGCGCGATTACTAGATCGATTCGATAACCG
ATATCCCGACGGCAGCTACGAGTATCGATTCGAGTTGGACGATGGAACCG
CTCGCTATGAACGTGGATATTTCGTTAAGATCAACGATGTAAAGACCCTG
ATGGTTGTGGGCTACTATGCCTATCGGATGACCGACGGGCGTTACATCAC
CGTCTTCTACAATGCCGATCAGTTTGGCTATCGACAGAATCAGTCGATCA
CGCCGCAGGAATATCCCAATCTGCCGCGTTCCATCGAGGTGCCCATGGTC
AGCGAGGCATCTGCGGCATCCGCGGCATCTGATGGCGTCTCCAGTTCCCA
GTTCCAATCTCAGTTTCAATCCCGTCTGGATGCCCATGGTAACCCCTCCA
TCACGACGACCACGCCCAGGGGGGCGGGGACAAATCGTAGGGGCCGCTAC
TGAGAGTTCGTAATTGCACACCATGCCCATTATTATTATTGGCTCCCTAC
ATCGTTTTTTATACCTTATTTTATTATTTTTTTTTTTTAATTTTGTGCCC
CCGACTACTCGTATTATATTATTATGAATTTAATTTCTGTCCACATTTTT
GTTGTGTTCAATGAAATGGGATTAAAAAATAATAAAAATTTATTAAGGCA
AAGCAGCGAAAAAAAAAAAAAAAAAA

LP12385.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr12A-RA 921 Cpr12A-RA 52..914 1..863 4315 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13434403..13434846 1..444 2160 99.1 Plus
chrX 22417052 chrX 13435255..13435668 445..858 2055 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13543643..13544086 1..444 2220 100 Plus
X 23542271 X 13544494..13544912 445..863 2095 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13551741..13552184 1..444 2220 100 Plus
X 23527363 X 13552592..13553010 445..863 2095 100 Plus
Blast to na_te.dros performed 2019-03-15 19:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1065..1190 679..805 164 60.9 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1086..1214 716..845 160 62.1 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1102..1213 679..785 151 63.4 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1079..1245 679..844 130 57.3 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1061..1200 704..845 127 58 Plus
Tabor 7345 Tabor TABOR 7345bp 1388..1537 815..663 119 58 Minus
Juan 4236 Juan JUAN 4236bp 4046..4191 858..698 113 58.6 Minus

LP12385.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:28 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13434403..13434846 1..444 99 -> Plus
chrX 13435255..13435625 445..815 91 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:11 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..522 132..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:32 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..522 132..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:20 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..522 132..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:38 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..522 132..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:11 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..522 132..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:15:34 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:32 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:20 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:38 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:11 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr12A-RA 1..858 1..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:28 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
X 13543643..13544086 1..444 100 -> Plus
X 13544494..13544907 445..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:28 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
X 13543643..13544086 1..444 100 -> Plus
X 13544494..13544907 445..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:28 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
X 13543643..13544086 1..444 100 -> Plus
X 13544494..13544907 445..858 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:20 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13438527..13438940 445..858 100   Plus
arm_X 13437676..13438119 1..444 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:56 Download gff for LP12385.complete
Subject Subject Range Query Range Percent Splice Strand
X 13551741..13552184 1..444 100 -> Plus
X 13552592..13553005 445..858 100   Plus

LP12385.hyp Sequence

Translation from 2 to 652

> LP12385.hyp
TSRDSTHTIHLRSPNIPHIHPTTTHKSHYIHISTHTFTPIRVKMATSGSI
LFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTA
RYERGYFVKINDVKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSIT
PQEYPNLPRSIEVPMVSEASAASAASDGVSSSQFQSQFQSRLDAHGNPSI
TTTTPRGAGTNRRGRY*

LP12385.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr12A-PA 173 CG15757-PA 1..173 44..216 886 100 Plus
CG15756-PA 298 CG15756-PA 80..185 61..166 223 41.5 Plus

LP12385.pep Sequence

Translation from 131 to 652

> LP12385.pep
MATSGSILFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRF
ELDDGTARYERGYFVKINDVKTLMVVGYYAYRMTDGRYITVFYNADQFGY
RQNQSITPQEYPNLPRSIEVPMVSEASAASAASDGVSSSQFQSQFQSRLD
AHGNPSITTTTPRGAGTNRRGRY*

LP12385.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22573-PA 170 GF22573-PA 1..132 1..126 547 81.1 Plus
Dana\GF22572-PA 277 GF22572-PA 92..185 30..123 215 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17788-PA 173 GG17788-PA 1..173 1..173 740 93.1 Plus
Dere\GG17787-PA 298 GG17787-PA 92..185 30..123 223 45.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12498-PA 166 GH12498-PA 11..166 10..173 474 58.4 Plus
Dgri\GH12497-PA 280 GH12497-PA 74..181 26..132 197 38.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr12A-PA 173 CG15757-PA 1..173 1..173 886 100 Plus
CG15756-PA 298 CG15756-PA 80..185 18..123 223 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14849-PA 191 GI14849-PA 36..135 28..127 455 82 Plus
Dmoj\GI14848-PA 287 GI14848-PA 57..164 18..121 182 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20236-PA 190 GL20236-PA 12..187 6..171 511 61.4 Plus
Dper\GL20235-PA 294 GL20235-PA 95..195 32..132 214 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13937-PA 190 GA13937-PA 46..187 31..171 507 71.1 Plus
Dpse\GA13936-PA 294 GA13936-PA 85..214 22..150 221 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17614-PA 173 GM17614-PA 1..173 1..173 884 97.7 Plus
Dsec\GM17612-PA 300 GM17612-PA 92..183 30..121 215 44.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17132-PA 173 GD17132-PA 1..173 1..173 884 97.7 Plus
Dsim\GD17131-PA 213 GD17131-PA 92..163 30..101 177 45.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19510-PA 184 GJ19510-PA 40..184 31..173 475 65.5 Plus
Dvir\GJ19507-PA 302 GJ19507-PA 93..182 32..121 222 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20084-PA 183 GK20084-PA 10..173 5..164 460 57.7 Plus
Dwil\GK20083-PA 279 GK20083-PA 101..219 33..151 204 35 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17084-PA 170 GE17084-PA 1..170 1..173 740 89.6 Plus
Dyak\GE17082-PA 306 GE17082-PA 87..183 27..123 224 45.4 Plus