Clone LP12691 Report

Search the DGRC for LP12691

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:126
Well:91
Vector:pOT2
Associated Gene/TranscriptCG16762-RA
Protein status:LP12691.pep: gold
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16762 2003-01-01 Sim4 clustering to Release 3
CG16762 2004-01-13 Blastp of sequenced clone
CG16762 2008-04-29 Release 5.5 accounting
CG16762 2008-08-15 Release 5.9 accounting
CG16762 2008-12-18 5.12 accounting

Clone Sequence Records

LP12691.complete Sequence

903 bp (903 high quality bases) assembled on 2004-01-13

GenBank Submission: BT011375

> LP12691.complete
GTGAATGGTGTATATCTGCAATGTGTCCCGAGATGTCGTCCGTGAAAATC
CTGGCCTCGCTGGCCATGATCGGTTTATTGGTTTTGTCTCCTGCGGAGGG
TATCAGCCGACCATTGCCTCCATACGTGGGTCTGCCCACCCAGGATGGCC
TCACGCGTCTGTTCCTTAATTCACGGGTCACGCAGACAGATCCCTTCGCC
TCGGTGGCATGTTTCGGTGGCTACATCGGTGAATCCAACCTGATCGCGGA
GCTGTACAGTGCCAACTACACCAAATGCTACAATGCGGCGGCGGACTCCA
GGAAGGGTATCGATGCCGACTTCCTGGCCACTCGCCGGACTATCCGACTT
TCATCCGAAAGAGTTTGCAGCGAGCTCAGGGCTTGCAACGAGCTCAACAC
AACCCTCGAATCCTTTCAATGTCATGCCAATGTGGGCTCCAACAACACTG
TCTCCACATACAGCATCTCGGGTAACGCCTCGGAGTCGGCCAGCGTGCTG
GAGGAACGCTACCGAGTGGTAGATCTGCGCCATGGGCAGTGCTGCCAGAG
GGCGGAGCGGCACTACGTGGAGTCCACTGCCAGGAACTACAACTACCTGC
AGGCCTGTCTGGATGGTCGCGCTAAGCCGAAGCCCATGCCCAAGCCCACA
TCCACGACCTCCACATCGACCACCACCACCACCACTACCACGACCACCGA
GGCACCCACCGAACCACCAACCACCACCGAGGCACCTTTAAACGTCGAAG
ATCAGTTCAAGCAGCTTTTGAATTTGTTAAACTAATGCCTACCAAATTGT
ACAACTTTCTGAAGGAGAAGCTTAGTAATTAAAGACAGGGCAGTCGCCAA
GCAAACAATCCTTGGGCAAACATTTGCCCAACTCGAAAAAAAAAAAAAAA
AAA

LP12691.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG16762-RA 1157 CG16762-RA 130..1017 1..888 4440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2474167..2474618 885..434 2155 98.5 Minus
chr3L 24539361 chr3L 2474680..2475114 435..1 2055 98.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2474664..2475118 888..434 2275 100 Minus
3L 28110227 3L 2475180..2475614 435..1 2175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2474664..2475118 888..434 2275 100 Minus
3L 28103327 3L 2475180..2475614 435..1 2175 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:26:42 has no hits.

LP12691.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:27:57 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2474167..2474617 435..885 91 <- Minus
chr3L 2474681..2475114 1..434 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:13 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:26 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:22:35 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:18 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:30 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:50:46 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:26 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..885 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:22:35 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..885 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:18 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..765 21..785 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:30 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
CG16762-RA 1..885 1..885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:57 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2474667..2475117 435..885 100 <- Minus
3L 2475181..2475614 1..434 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:57 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2474667..2475117 435..885 100 <- Minus
3L 2475181..2475614 1..434 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:57 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2474667..2475117 435..885 100 <- Minus
3L 2475181..2475614 1..434 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:22:35 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2474667..2475117 435..885 100 <- Minus
arm_3L 2475181..2475614 1..434 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:44 Download gff for LP12691.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2475181..2475614 1..434 100   Minus
3L 2474667..2475117 435..885 100 <- Minus

LP12691.hyp Sequence

Translation from 2 to 784

> LP12691.hyp
EWCISAMCPEMSSVKILASLAMIGLLVLSPAEGISRPLPPYVGLPTQDGL
TRLFLNSRVTQTDPFASVACFGGYIGESNLIAELYSANYTKCYNAAADSR
KGIDADFLATRRTIRLSSERVCSELRACNELNTTLESFQCHANVGSNNTV
STYSISGNASESASVLEERYRVVDLRHGQCCQRAERHYVESTARNYNYLQ
ACLDGRAKPKPMPKPTSTTSTSTTTTTTTTTTEAPTEPPTTTEAPLNVED
QFKQLLNLLN*

LP12691.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG16762-PA 254 CG16762-PA 1..254 7..260 1312 100 Plus
CG10911-PA 359 CG10911-PA 3..221 14..244 252 29.7 Plus
CG5767-PA 253 CG5767-PA 1..236 14..245 229 26.7 Plus
CG5770-PA 213 CG5770-PA 25..206 47..233 204 26.7 Plus
CG11470-PB 230 CG11470-PB 8..227 25..235 203 27.3 Plus

LP12691.pep Sequence

Translation from 20 to 784

> LP12691.pep
MCPEMSSVKILASLAMIGLLVLSPAEGISRPLPPYVGLPTQDGLTRLFLN
SRVTQTDPFASVACFGGYIGESNLIAELYSANYTKCYNAAADSRKGIDAD
FLATRRTIRLSSERVCSELRACNELNTTLESFQCHANVGSNNTVSTYSIS
GNASESASVLEERYRVVDLRHGQCCQRAERHYVESTARNYNYLQACLDGR
AKPKPMPKPTSTTSTSTTTTTTTTTTEAPTEPPTTTEAPLNVEDQFKQLL
NLLN*

LP12691.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24864-PA 250 GF24864-PA 1..250 5..254 844 71.3 Plus
Dana\GF13208-PA 377 GF13208-PA 37..227 48..239 240 30.6 Plus
Dana\GF22881-PA 228 GF22881-PA 8..216 16..222 156 27 Plus
Dana\GF13211-PA 249 GF13211-PA 1..185 8..197 150 25.5 Plus
Dana\GF11688-PA 135 GF11688-PA 11..129 79..197 140 26.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14514-PA 249 GG14514-PA 1..249 5..254 1076 90.8 Plus
Dere\GG20997-PA 383 GG20997-PA 22..197 33..213 215 28.7 Plus
Dere\GG12014-PA 210 GG12014-PA 2..210 5..218 198 29.9 Plus
Dere\GG21000-PA 300 GG21000-PA 1..185 8..197 178 26.6 Plus
Dere\GG21837-PA 184 GG21837-PA 45..178 64..197 152 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15758-PA 256 GH15758-PA 9..256 14..254 722 61.7 Plus
Dgri\GH20448-PA 278 GH20448-PA 5..184 19..199 271 33.5 Plus
Dgri\GH20449-PA 205 GH20449-PA 5..194 19..219 196 28.6 Plus
Dgri\GH20451-PA 184 GH20451-PA 20..173 62..219 168 27.8 Plus
Dgri\GH21443-PA 174 GH21443-PA 30..167 64..201 167 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16762-PA 254 CG16762-PA 1..254 1..254 1312 100 Plus
CG10911-PA 359 CG10911-PA 3..221 8..238 252 29.7 Plus
CG5767-PA 253 CG5767-PA 1..236 8..239 229 26.7 Plus
CG5770-PA 213 CG5770-PA 25..206 41..227 204 26.7 Plus
CG11470-PB 230 CG11470-PB 8..227 19..229 203 27.3 Plus
CG11470-PA 230 CG11470-PA 8..227 19..229 203 27.3 Plus
CG7567-PA 211 CG7567-PA 3..210 6..218 201 28.1 Plus
CG10912-PA 271 CG10912-PA 5..223 16..239 193 25.9 Plus
Muc55B-PB 485 CG5765-PB 56..240 64..240 192 27 Plus
Muc55B-PA 485 CG5765-PA 56..240 64..240 192 27 Plus
CG34005-PC 185 CG34005-PC 46..179 64..197 164 26.9 Plus
CG34005-PB 185 CG34005-PB 46..179 64..197 164 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12536-PA 253 GI12536-PA 3..253 5..254 777 65 Plus
Dmoj\GI19278-PA 253 GI19278-PA 7..203 17..218 236 29.2 Plus
Dmoj\GI24460-PA 223 GI24460-PA 39..189 50..199 199 31.8 Plus
Dmoj\GI24462-PA 213 GI24462-PA 46..211 63..218 188 31.9 Plus
Dmoj\GI24461-PA 231 GI24461-PA 6..231 16..237 175 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24611-PA 258 GL24611-PA 22..258 21..254 772 72.2 Plus
Dper\GL10540-PA 356 GL10540-PA 7..193 21..207 241 31.4 Plus
Dper\GL13587-PA 220 GL13587-PA 22..204 34..218 225 31.7 Plus
Dper\GL11526-PA 186 GL11526-PA 47..180 64..197 177 27.6 Plus
Dper\GL13586-PA 221 GL13586-PA 55..218 64..219 175 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14134-PA 258 GA14134-PA 22..258 21..254 772 72.2 Plus
Dpse\GA10635-PA 372 GA10635-PA 3..193 15..207 241 30.4 Plus
Dpse\GA26834-PA 218 GA26834-PA 22..204 34..218 225 31.7 Plus
Dpse\GA24760-PA 186 GA24760-PA 47..180 64..197 176 27.6 Plus
Dpse\GA26833-PA 221 GA26833-PA 55..218 64..239 171 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14119-PA 239 GM14119-PA 1..239 1..254 992 86.6 Plus
Dsec\GM19931-PA 366 GM19931-PA 1..197 10..215 215 27.7 Plus
Dsec\GM12239-PA 211 GM12239-PA 54..210 58..218 190 29.8 Plus
Dsec\GM19934-PA 253 GM19934-PA 7..185 21..197 157 29.1 Plus
Dsec\GM21839-PA 189 GM21839-PA 51..184 64..197 154 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13390-PA 250 GD13390-PA 1..250 5..254 1295 98 Plus
Dsim\GD25420-PA 381 GD25420-PA 1..197 10..215 209 27.7 Plus
Dsim\GD17731-PA 199 GD17731-PA 42..198 58..218 201 31.1 Plus
Dsim\GD25424-PA 212 GD25424-PA 25..204 41..223 179 27.8 Plus
Dsim\GD25423-PA 253 GD25423-PA 7..185 21..197 157 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16053-PA 252 GJ16053-PA 9..252 14..254 781 65.6 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 3..184 17..199 268 33.7 Plus
Dvir\GJ10551-PA 211 GJ10551-PA 7..211 17..227 216 31.1 Plus
Dvir\GJ10550-PA 211 GJ10550-PA 20..187 31..199 201 30 Plus
Dvir\GJ10549-PA 211 GJ10549-PA 20..187 31..199 199 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12510-PA 326 GK12510-PA 3..223 8..233 770 70.4 Plus
Dwil\GK22059-PA 340 GK22059-PA 1..185 10..207 250 31.8 Plus
Dwil\GK22242-PA 168 GK22242-PA 25..163 61..199 187 30.2 Plus
Dwil\GK22057-PA 259 GK22057-PA 29..227 41..243 183 30.6 Plus
Dwil\GK11180-PA 229 GK11180-PA 61..197 64..199 174 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21706-PA 254 GE21706-PA 1..254 1..254 1100 91.3 Plus
Dyak\GE10450-PA 211 GE10450-PA 6..211 13..218 210 28.6 Plus
Dyak\GE13940-PA 406 GE13940-PA 3..191 8..203 192 26 Plus
Dyak\GE13943-PA 274 GE13943-PA 7..185 21..197 174 27.9 Plus
Dyak\GE11916-PA 184 GE11916-PA 45..178 64..197 156 26.9 Plus