Clone LP12967 Report

Search the DGRC for LP12967

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:129
Well:67
Vector:pOT2
Associated Gene/TranscriptCG34461-RA
Protein status:LP12967.pep: gold
Sequenced Size:686

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7072 2003-01-01 Sim4 clustering to Release 3
CG7072 2004-08-13 Blastp of sequenced clone
CG34461 2008-04-29 Release 5.5 accounting
CG34461 2008-08-15 Release 5.9 accounting
CG34461 2008-12-18 5.12 accounting

Clone Sequence Records

LP12967.complete Sequence

686 bp (686 high quality bases) assembled on 2004-08-13

GenBank Submission: BT016066

> LP12967.complete
CGATTTCGTGCTCTTAACGGTCCTCACTTACTCGAGCTCACTCCTTACAG
CCTCCTCTACAGGATTCAGCGTCCAGTCGTCCTTCGTCCTTGTTTTTAGC
TACGTGTTCGCGCCGTGTGTCCGTTTGCCGTTCGTGCTCGATAATTAAAA
TGAAGTACTTCGTTGCCATCGCTCTGCTGTTCGCCGCCGCTCAGGCTGTT
CCCATCGAGCTGGGCCACTACGCCCCTGCGCTGGTGCATCATGCGCCAGT
CCTGTCGCACGCCGTCCATGCCGTCCACGCCGAGCCGGTGGCCTATCCCA
AGTACTCCTTCAACTACGGCATTAAGGATCCCCACACCGGCGACATCAAG
TCGCAGGCCGAGGAGCGCGACGGCGATGTGGTGAAGGGCCAGTACTCCCT
GGTTGAGCCCGATGGTTCGGTGCGCACCGTTGACTACACCGCCGACGACC
ACAATGGCTTCAATGCCGTCGTCCACAAGACCGCCCCCAGTAAGATCATC
GCCCATGCACCCGTGCTGCATGCCGCCCCCGTTTTGGCCCACGCCCCCCT
TCTGCATCACTACTAAGAAGCGGGAGCCTGACTTAGTCACCAAGGTGCTC
TCCCTCTCGCTCTCATCCATTCACACCAGAATCTTCATAGGAACAACAAC
AAACAGAAAAACAAACAAAAAAAAAAAAAAAAAAAA

LP12967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34461.b 1943 CG34461.b 141..826 1..686 3400 99.7 Plus
CG34461.d 1160 CG34461.d 141..826 1..686 3400 99.7 Plus
CG34461.a 2031 CG34461.a 141..826 1..686 3400 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8318891..8319170 387..666 1370 99.3 Plus
chr3L 24539361 chr3L 8318198..8318432 154..388 1115 98.3 Plus
chr3L 24539361 chr3L 8317927..8318081 1..155 760 99.4 Plus
chr3L 24539361 chr3L 1840519..1840731 489..277 495 82.2 Minus
chr3L 24539361 chr3L 8329958..8330146 296..484 375 79.9 Plus
chr2L 23010047 chr2L 9931646..9931779 466..333 205 76.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8326836..8327135 387..686 1470 99.3 Plus
3L 28110227 3L 8326146..8326380 154..388 1175 100 Plus
3L 28110227 3L 8325874..8326028 1..155 775 100 Plus
3L 28110227 3L 1840989..1841201 489..277 465 81.2 Minus
3L 28110227 3L 8337917..8338105 296..484 375 79.9 Plus
2L 23513712 2L 9932732..9932865 466..333 205 76.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8319936..8320235 387..686 1470 99.3 Plus
3L 28103327 3L 8319246..8319480 154..388 1175 100 Plus
3L 28103327 3L 8318974..8319128 1..155 775 100 Plus
3L 28103327 3L 1840989..1841145 489..333 440 85.3 Minus
3L 28103327 3L 8331017..8331205 296..484 375 79.8 Plus
2L 23513712 2L 9932732..9932865 466..333 205 76.8 Minus
Blast to na_te.dros performed on 2019-03-15 13:59:19 has no hits.

LP12967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:00:00 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8318200..8318431 156..387 98 -> Plus
chr3L 8318892..8319149 388..645 99 -> Plus
chr3L 8317927..8318081 1..155 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:17 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 1..417 150..566 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:08 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 1..417 150..566 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:20:09 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 1..417 150..566 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:03 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 1..417 150..566 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:48:13 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 1..417 150..566 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:38:50 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 12..677 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:08 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 12..677 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:20:09 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 16..681 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:04 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 12..677 1..666 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:48:13 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34461-RA 16..681 1..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:00 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8325874..8326028 1..155 100 -> Plus
3L 8326148..8326379 156..387 100 -> Plus
3L 8326837..8327115 388..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:00 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8325874..8326028 1..155 100 -> Plus
3L 8326148..8326379 156..387 100 -> Plus
3L 8326837..8327115 388..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:00 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8325874..8326028 1..155 100 -> Plus
3L 8326148..8326379 156..387 100 -> Plus
3L 8326837..8327115 388..666 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:20:09 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8318974..8319128 1..155 100 -> Plus
arm_3L 8319248..8319479 156..387 100 -> Plus
arm_3L 8319937..8320215 388..666 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:02 Download gff for LP12967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8319248..8319479 156..387 100 -> Plus
3L 8319937..8320215 388..666 100   Plus
3L 8318974..8319128 1..155 100 -> Plus

LP12967.pep Sequence

Translation from 149 to 565

> LP12967.pep
MKYFVAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYP
KYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADD
HNGFNAVVHKTAPSKIIAHAPVLHAAPVLAHAPLLHHY*

LP12967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10287-PA 375 GF10287-PA 1..109 3..114 532 92.9 Plus
Dana\GF24956-PA 188 GF24956-PA 4..119 1..114 318 58.1 Plus
Dana\GF24957-PA 189 GF24957-PA 33..118 50..138 295 66.3 Plus
Dana\GF10288-PA 157 GF10288-PA 75..145 43..113 292 77.5 Plus
Dana\GF23679-PA 196 GF23679-PA 77..142 45..110 253 72.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14555-PA 180 GG14555-PA 4..116 1..114 304 58.1 Plus
Dere\GG14556-PA 228 GG14556-PA 33..118 50..138 298 66.3 Plus
Dere\GG14302-PA 162 GG14302-PA 77..150 40..113 295 75.7 Plus
Dere\GG16039-PA 198 GG16039-PA 60..144 22..110 258 60.7 Plus
Dere\GG13610-PA 183 GG13610-PA 33..95 48..110 239 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15052-PA 136 GH15052-PA 1..136 1..138 597 90.7 Plus
Dgri\GH15041-PA 182 GH15041-PA 4..145 1..135 325 51.4 Plus
Dgri\GH15054-PA 167 GH15054-PA 60..149 20..113 301 66 Plus
Dgri\GH15042-PA 191 GH15042-PA 33..118 50..138 292 65.2 Plus
Dgri\GH17178-PA 200 GH17178-PA 85..162 45..126 251 62.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34461-PB 138 CG34461-PB 1..138 1..138 731 100 Plus
CG34461-PA 138 CG34461-PA 1..138 1..138 731 100 Plus
Cpr62Bc-PB 180 CG1919-PB 5..146 2..138 359 54.7 Plus
Cpr62Bc-PA 180 CG1919-PA 5..146 2..138 359 54.7 Plus
Cpr66Cb-PA 162 CG7076-PA 58..162 20..138 322 58 Plus
Cpr62Bb-PC 194 CG13935-PC 32..118 49..138 314 65.6 Plus
Cpr62Bb-PB 194 CG13935-PB 32..118 49..138 314 65.6 Plus
Cpr62Bb-PA 194 CG13935-PA 32..118 49..138 314 65.6 Plus
Cpr92A-PA 245 CG6240-PA 29..145 16..133 278 52.1 Plus
Ccp84Ad-PA 199 CG2341-PA 5..151 4..138 271 46.4 Plus
Ccp84Ab-PA 221 CG1252-PA 11..151 4..138 270 49.3 Plus
Ccp84Aa-PA 205 CG2360-PA 11..151 4..138 264 48.6 Plus
Cpr76Bb-PA 198 CG9290-PA 60..144 22..110 262 59.6 Plus
Cpr76Bd-PD 1228 CG9299-PD 1107..1220 14..118 251 52.6 Plus
Cpr76Bd-PB 1228 CG9299-PB 1107..1220 14..118 251 52.6 Plus
Cpr76Bd-PC 1231 CG9299-PC 1110..1223 14..118 251 52.6 Plus
Cpr64Ad-PB 247 CG1259-PB 89..233 4..133 249 45.9 Plus
Ccp84Ae-PA 208 CG1330-PA 4..134 2..134 248 44.1 Plus
Cpr76Ba-PA 204 CG9283-PA 72..168 30..120 245 51.5 Plus
Cpr5C-PA 145 CG4052-PA 5..141 4..130 243 44.6 Plus
Cpr30F-PA 146 CG31876-PA 14..125 13..134 241 48.8 Plus
Ccp84Af-PA 151 CG1331-PA 4..151 2..137 239 41.1 Plus
Cpr64Aa-PA 192 CG15006-PA 4..149 2..133 238 40.4 Plus
Ccp84Ac-PA 217 CG1327-PA 9..150 5..132 235 43 Plus
Edg84A-PA 188 CG2345-PA 33..152 48..136 233 45 Plus
Cpr64Ac-PA 188 CG15008-PA 37..170 2..130 229 42.5 Plus
Cpr23B-PA 302 CG2973-PA 136..231 33..126 223 49 Plus
Cpr76Bc-PD 424 CG9295-PD 56..112 52..108 223 70.2 Plus
Cpr76Bc-PC 424 CG9295-PC 56..112 52..108 223 70.2 Plus
Ccp84Ag-PA 191 CG2342-PA 7..140 9..138 220 41.5 Plus
Cpr64Ab-PA 120 CG15007-PA 32..119 42..129 218 54.9 Plus
Crys-PB 477 CG16963-PB 75..135 50..110 217 65.6 Plus
Crys-PA 477 CG16963-PA 75..135 50..110 217 65.6 Plus
Cpr35B-PA 218 CG3474-PA 4..130 2..110 212 40.2 Plus
Cpr30B-PA 153 CG3818-PA 13..125 35..137 210 45.2 Plus
Cpr31A-PA 340 CG33302-PA 104..218 25..137 204 45.3 Plus
CG13670-PA 266 CG13670-PA 98..188 47..137 182 41.8 Plus
CG42367-PC 103 CG42367-PC 31..102 45..115 180 51.4 Plus
Cpr66D-PA 270 CG32029-PA 158..226 52..121 149 42.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12819-PA 389 GI12819-PA 18..129 1..113 472 89.6 Plus
Dmoj\GI12933-PA 163 GI12933-PA 4..132 1..138 344 55.3 Plus
Dmoj\GI11675-PA 176 GI11675-PA 51..149 48..132 310 63.6 Plus
Dmoj\GI12820-PA 164 GI12820-PA 47..149 11..113 303 60.2 Plus
Dmoj\GI11676-PA 187 GI11676-PA 33..118 50..138 303 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24692-PA 133 GL24692-PA 1..133 1..138 542 91.3 Plus
Dper\GL24822-PA 183 GL24822-PA 49..147 48..138 304 62.6 Plus
Dper\GL24824-PA 195 GL24824-PA 33..118 50..138 299 67.4 Plus
Dper\GL24694-PA 159 GL24694-PA 77..147 43..113 293 77.5 Plus
Dper\GL20937-PA 198 GL20937-PA 79..144 45..110 255 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23954-PA 133 GA23954-PA 1..133 1..138 542 91.3 Plus
Dpse\GA15131-PA 183 GA15131-PA 49..147 48..138 317 64.6 Plus
Dpse\GA12639-PA 195 GA12639-PA 33..118 50..138 299 67.4 Plus
Dpse\GA20083-PA 159 GA20083-PA 77..147 43..113 293 77.5 Plus
Dpse\GA21674-PA 198 GA21674-PA 79..144 45..110 255 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14163-PA 180 GM14163-PA 4..116 1..114 314 59 Plus
Dsec\GM25044-PA 162 GM25044-PA 58..150 20..113 300 67 Plus
Dsec\GM14164-PA 225 GM14164-PA 33..118 50..138 298 66.3 Plus
Dsec\GM19580-PA 198 GM19580-PA 79..144 45..110 253 72.7 Plus
Dsec\GM10909-PA 188 GM10909-PA 35..95 50..110 241 68.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14078-PA 177 GD14078-PA 42..177 3..138 669 97.1 Plus
Dsim\GD13434-PA 180 GD13434-PA 4..116 1..114 314 59 Plus
Dsim\GD17606-PA 192 GD17606-PA 33..118 50..138 303 66.3 Plus
Dsim\GD18466-PA 62 GD18466-PA 1..62 77..138 300 93.5 Plus
Dsim\GD14081-PA 162 GD14081-PA 58..150 20..113 300 67 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12961-PA 135 GJ12961-PA 1..135 1..138 554 91.4 Plus
Dvir\GJ12945-PA 178 GJ12945-PA 4..138 1..123 317 53.2 Plus
Dvir\GJ12946-PA 185 GJ12946-PA 33..118 50..138 299 66.3 Plus
Dvir\GJ12963-PA 164 GJ12963-PA 60..149 20..113 298 66 Plus
Dvir\GJ13494-PA 198 GJ13494-PA 77..142 45..110 252 71.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11910-PA 389 GK11910-PA 1..112 3..113 560 97.3 Plus
Dwil\GK20563-PA 184 GK20563-PA 4..141 1..132 324 54.5 Plus
Dwil\GK20564-PA 195 GK20564-PA 33..118 50..138 300 67.4 Plus
Dwil\GK11921-PA 158 GK11921-PA 63..146 30..113 293 69 Plus
Dwil\GK24776-PA 148 GK24776-PA 13..118 12..122 235 47.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20909-PA 180 GE20909-PA 4..116 1..114 314 59 Plus
Dyak\GE20730-PA 162 GE20730-PA 58..150 20..113 300 67 Plus
Dyak\GE20910-PA 229 GE20910-PA 33..118 50..138 298 66.3 Plus
Dyak\GE19605-PA 195 GE19605-PA 54..141 24..110 262 60.2 Plus
Dyak\GE23205-PA 198 GE23205-PA 60..144 22..110 261 60.7 Plus

LP12967.hyp Sequence

Translation from 149 to 565

> LP12967.hyp
MKYFVAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYP
KYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADD
HNGFNAVVHKTAPSKIIAHAPVLHAAPVLAHAPLLHHY*

LP12967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34461-PB 138 CG34461-PB 1..138 1..138 731 100 Plus
CG34461-PA 138 CG34461-PA 1..138 1..138 731 100 Plus
Cpr62Bc-PB 180 CG1919-PB 5..146 2..138 359 54.7 Plus
Cpr62Bc-PA 180 CG1919-PA 5..146 2..138 359 54.7 Plus
Cpr66Cb-PA 162 CG7076-PA 58..162 20..138 322 58 Plus