Clone LP13032 Report

Search the DGRC for LP13032

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:130
Well:32
Vector:pOT2
Associated Gene/TranscriptCG12379-RB
Protein status:LP13032.pep: gold
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12379 2003-01-01 Sim4 clustering to Release 3
CG12379 2008-04-29 Release 5.5 accounting
CG12379 2008-08-15 Release 5.9 accounting
CG12379 2008-12-18 5.12 accounting

Clone Sequence Records

LP13032.complete Sequence

580 bp (580 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011539

> LP13032.complete
CAGACAAAATCGAGGATATGTCCGCCCTAAAAAAATTTTATAAAATCAGC
GCAGGTGTGAGAAGAGGCGCACTACTTACCAGTTCCCGAAGAACACAAAT
TGATGCTTTAAATAGTCCACAATTGCAGTTGCAAGTGCATCACTTTGCAA
CCAAAACACAAACAGCTGTTTTTAGCAGCAGCAACAACTACACGTGCATT
TGCCGCAGTATACACTGCAGTAAGCCAGTGGACGATGCGGACAAGACGGT
GGCCACGAATAGCATTCCTCTGGCGAAACTGGAGGCCAAGATGCAGCTGA
TCTACACCTGCAAGGTGTGCCAGACCCGGAACATGAAGACCATTTCGAAG
CTGGCATACCAACGCGGCGTTGTTATCGTGACCTGCGAGGGCTGCTCCAA
TCACCACCTGATCGCCGACAATCTGAACTGGTTCACAGATCTGGACGGCA
AGCGCAACATCGAGGAGATCCTGGCCGAGAAGGGCGAGAAGGTGGTTCGC
CTGACCGATGGCAACTGCGAGTTTTTGCCGAAACATGATTAAACTCGTAG
TGTAGTTAAGTGAAAAAAAAAAAAAAAAAA

LP13032.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12379-RB 772 CG12379-RB 207..769 4..566 2815 100 Plus
CG8191-RA 1485 CG8191-RA 1037..1373 566..230 1685 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15623058..15623390 562..230 1665 100 Minus
chrX 22417052 chrX 15623546..15623773 231..4 1140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15733218..15733554 566..230 1685 100 Minus
X 23542271 X 15733710..15733937 231..4 1140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15741316..15741652 566..230 1685 100 Minus
X 23527363 X 15741808..15742035 231..4 1140 100 Minus
Blast to na_te.dros performed 2019-03-15 20:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6749..6866 117..229 127 60.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9156..9219 146..210 115 66.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 126..189 146..210 115 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2405 147..223 112 62.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6879 117..222 109 58.6 Plus

LP13032.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:36 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15623058..15623389 231..562 100 <- Minus
chrX 15623547..15623775 1..230 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:18 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..525 18..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:43 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..525 18..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:05:40 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..525 18..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:33 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..525 18..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:04 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..525 18..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:46 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..561 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:43 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..561 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:40 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 58..618 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:33 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 1..561 1..562 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:04 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
CG12379-RB 58..618 1..562 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:36 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
X 15733222..15733553 231..562 100 <- Minus
X 15733711..15733939 1..230 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:36 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
X 15733222..15733553 231..562 100 <- Minus
X 15733711..15733939 1..230 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:36 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
X 15733222..15733553 231..562 100 <- Minus
X 15733711..15733939 1..230 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:40 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15627255..15627586 231..562 100 <- Minus
arm_X 15627744..15627972 1..230 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:58 Download gff for LP13032.complete
Subject Subject Range Query Range Percent Splice Strand
X 15741320..15741651 231..562 100 <- Minus
X 15741809..15742037 1..230 99   Minus

LP13032.hyp Sequence

Translation from 0 to 541

> LP13032.hyp
NKIEDMSALKKFYKISAGVRRGALLTSSRRTQIDALNSPQLQLQVHHFAT
KTQTAVFSSSNNYTCICRSIHCSKPVDDADKTVATNSIPLAKLEAKMQLI
YTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHHLIADNLNWFTDLDGK
RNIEEILAEKGEKVVRLTDGNCEFLPKHD*

LP13032.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG12379-PB 174 CG12379-PB 1..174 6..179 909 100 Plus
CG8206-PB 191 CG8206-PB 97..179 92..164 194 44.6 Plus
CG8206-PA 191 CG8206-PA 97..179 92..164 194 44.6 Plus

LP13032.pep Sequence

Translation from 2 to 541

> LP13032.pep
DKIEDMSALKKFYKISAGVRRGALLTSSRRTQIDALNSPQLQLQVHHFAT
KTQTAVFSSSNNYTCICRSIHCSKPVDDADKTVATNSIPLAKLEAKMQLI
YTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHHLIADNLNWFTDLDGK
RNIEEILAEKGEKVVRLTDGNCEFLPKHD*

LP13032.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22240-PA 169 GF22240-PA 1..168 6..179 603 68.6 Plus
Dana\GF19477-PA 190 GF19477-PA 96..148 92..144 171 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19380-PA 121 GG19380-PA 19..121 77..179 548 98.1 Plus
Dere\GG17905-PA 191 GG17905-PA 95..179 90..164 184 43.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24435-PA 164 GH24435-PA 1..163 6..177 414 51.4 Plus
Dgri\GH24157-PA 181 GH24157-PA 100..169 92..164 185 45.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG12379-PB 174 CG12379-PB 1..174 6..179 909 100 Plus
CG8206-PB 191 CG8206-PB 97..179 92..164 194 44.6 Plus
CG8206-PA 191 CG8206-PA 97..179 92..164 194 44.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16194-PA 108 GI16194-PA 7..106 77..176 422 76 Plus
Dmoj\GI14660-PA 187 GI14660-PA 96..175 92..164 194 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16522-PA 188 GL16522-PA 1..182 6..179 565 60.1 Plus
Dper\GL15020-PA 187 GL15020-PA 95..175 90..164 206 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11595-PA 178 GA11595-PA 1..172 6..179 559 61.6 Plus
Dpse\GA20897-PA 187 GA20897-PA 97..175 92..164 199 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22535-PA 119 GM22535-PA 17..119 77..179 555 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15783-PA 119 GD15783-PA 17..119 77..179 557 100 Plus
Dsim\GD17233-PA 191 GD17233-PA 95..179 90..164 184 43.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16534-PA 165 GJ16534-PA 1..162 6..175 434 55.7 Plus
Dvir\GJ14731-PA 181 GJ14731-PA 96..169 92..164 205 48.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20094-PA 96 GK20094-PA 1..83 97..179 400 85.5 Plus
Dwil\GK25634-PA 200 GK25634-PA 92..188 90..164 172 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16027-PA 177 GE16027-PA 1..177 6..179 829 87.6 Plus
Dyak\GE17213-PA 191 GE17213-PA 95..179 90..164 184 43.5 Plus