Clone LP13353 Report

Search the DGRC for LP13353

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:133
Well:53
Vector:pOT2
Associated Gene/TranscriptCG5910-RA
Protein status:LP13353.pep: gold
Sequenced Size:1167

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5910 2003-01-01 Sim4 clustering to Release 3
CG5910 2004-10-02 Blastp of sequenced clone
CG5910 2008-04-29 Release 5.5 accounting
CG5910 2008-08-15 Release 5.9 accounting
CG5910 2008-12-18 5.12 accounting

Clone Sequence Records

LP13353.complete Sequence

1167 bp (1167 high quality bases) assembled on 2004-10-02

GenBank Submission: BT016064

> LP13353.complete
GGAATCGGACGTGTGCCCGTCGATCTTGATGCGAAAACCATCGCGGCGTT
GGGACAAATACCTACAAGTATCTGTGCACTCCGCCTCCTCACGTGCGTGT
GTGATATTTGTAACTTTAATTTATGGGATGCGTTGAATTGTATCCGATCC
GATTGCTGCGACCGCAACGAAATAAAACGCCAATGAAACCCAACTAATTG
ATGTGATAATGCTGCACATGGAAATCATCCAATTCAGACAACGTCACACG
ATGTGGAACTTTTTGGATCGCTTCGAACTGGACGCAGAGGATCGACAGTG
CCTCGAGAGATTACAGCAGCCGGCGGAAAGATCCACCGATAAGAGCTTCA
CACCAAAGGTCAGTTTGCGTTATCAGCCCGCGATCGTCCCATCATTCCTG
TCTATTGGGATTGCGGTGACTATCTGCCTGGGATCTGCCCTCGCCGCTCC
GCAATCCTCCTGCATCATGTGCGACAAGGAGGACCTGCGACCACGACTTC
CTCCCTACAGCGACAGCTACGAGGAGTACACCTTCGACCACCAGGTGACC
CAGCAAGCGGCCCTGGAGTCCATTCAGAAATTTAACGGCTCAAGAGGTCA
GAACAATGCCTGCAGTTCAATCAAGTGCCCACCGAATACACCAAAGTATT
GCCTAGGCGGTCAGTTTATCAACGACCATTGCTGGTGCGAACTGCAACAC
AGAGAAGAGGGCCTGCCCTATGTGCCTCACGTGTGCTTCGCGGATCAGAA
GGTGCACACATCATCCGTGGAATCCTGCTTCACATTCGTCCAGGTCAAGG
AGTGCTGCTGTGCTGAGATCTGGATCAAGAAGTGGCGTCACATTTCCGGC
AGTTCTCGTGGCCAGCACGTGCCAAATGTGTTAGTGCTACTAATATTGAA
CCTGCTTTCTGCATTCAGTATACTCACCTGCCGAAGAAGGAGACGAATAT
TTTGGCAAAGCTAAGATTTCGAGGGGAAGTCATGATGTGAGAAAACTTGT
TGTACAGCGTGAAGTCAGTCATAGAGAAGTAGGATCTAGTCGTAGTAGCA
TTCAAATAAGTGTACTTAGTTCAACAAATGTCCAGTGGTAATCAAACTTA
CTTGCTAAGCATATATTTAAGCGTTAATAAATACACGTTTATAATGCTAA
AAAAAAAAAAAAAAAAA

LP13353.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5910-RB 1254 CG5910-RB 62..1211 1..1150 5750 100 Plus
CG5910.b 1121 CG5910.b 69..1083 136..1150 5075 100 Plus
CG5910.d 1194 CG5910.d 138..1151 137..1150 5070 100 Plus
CG5910.d 1194 CG5910.d 46..137 1..92 460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20434975..20435428 137..590 2270 100 Plus
chr3L 24539361 chr3L 20439273..20439587 834..1148 1575 100 Plus
chr3L 24539361 chr3L 20434185..20434320 1..136 680 100 Plus
chr3L 24539361 chr3L 20438516..20438644 706..834 645 100 Plus
chr3L 24539361 chr3L 20435773..20435846 591..664 370 100 Plus
chr3L 24539361 chr3L 20435910..20435955 662..707 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20445948..20446401 137..590 2270 100 Plus
3L 28110227 3L 20450266..20450582 834..1150 1585 100 Plus
3L 28110227 3L 20445158..20445293 1..136 680 100 Plus
3L 28110227 3L 20449508..20449636 706..834 645 100 Plus
3L 28110227 3L 20446746..20446819 591..664 370 100 Plus
3L 28110227 3L 20446877..20446922 662..707 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20439048..20439501 137..590 2270 100 Plus
3L 28103327 3L 20443366..20443682 834..1150 1585 100 Plus
3L 28103327 3L 20438258..20438393 1..136 680 100 Plus
3L 28103327 3L 20442608..20442736 706..834 645 100 Plus
3L 28103327 3L 20439846..20439919 591..664 370 100 Plus
3L 28103327 3L 20439977..20440022 662..707 230 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:38:51 has no hits.

LP13353.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:34 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20438518..20438643 708..833 100 -> Plus
chr3L 20439273..20439587 834..1148 100   Plus
chr3L 20434185..20434320 1..136 100 -> Plus
chr3L 20434975..20435428 137..590 100 -> Plus
chr3L 20435773..20435846 591..664 100 -> Plus
chr3L 20435913..20435955 665..707 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:24 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..756 209..964 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:31:33 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..756 209..964 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:38:10 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RA 1..756 209..964 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:15:24 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RA 1..756 209..964 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:36 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RA 1..756 209..964 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:36:23 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..1148 1..1148 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:31:33 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..1148 1..1148 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:10 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..1148 1..1148 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:15:25 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RA 51..1063 136..1148 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:36 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
CG5910-RB 1..1148 1..1148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:34 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20446746..20446819 591..664 100 -> Plus
3L 20446880..20446922 665..707 100 -> Plus
3L 20449510..20449635 708..833 100 -> Plus
3L 20445158..20445293 1..136 100 -> Plus
3L 20445948..20446401 137..590 100 -> Plus
3L 20450266..20450580 834..1148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:34 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20446746..20446819 591..664 100 -> Plus
3L 20446880..20446922 665..707 100 -> Plus
3L 20449510..20449635 708..833 100 -> Plus
3L 20445158..20445293 1..136 100 -> Plus
3L 20445948..20446401 137..590 100 -> Plus
3L 20450266..20450580 834..1148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:34 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20446746..20446819 591..664 100 -> Plus
3L 20446880..20446922 665..707 100 -> Plus
3L 20449510..20449635 708..833 100 -> Plus
3L 20445158..20445293 1..136 100 -> Plus
3L 20445948..20446401 137..590 100 -> Plus
3L 20450266..20450580 834..1148 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:10 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20438258..20438393 1..136 100 -> Plus
arm_3L 20439048..20439501 137..590 100 -> Plus
arm_3L 20439846..20439919 591..664 100 -> Plus
arm_3L 20439980..20440022 665..707 100 -> Plus
arm_3L 20442610..20442735 708..833 100 -> Plus
arm_3L 20443366..20443680 834..1148 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:19 Download gff for LP13353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20439048..20439501 137..590 100 -> Plus
3L 20439846..20439919 591..664 100 -> Plus
3L 20439980..20440022 665..707 100 -> Plus
3L 20442610..20442735 708..833 100 -> Plus
3L 20443366..20443680 834..1148 100   Plus
3L 20438258..20438393 1..136 100 -> Plus

LP13353.hyp Sequence

Translation from 208 to 963

> LP13353.hyp
MLHMEIIQFRQRHTMWNFLDRFELDAEDRQCLERLQQPAERSTDKSFTPK
VSLRYQPAIVPSFLSIGIAVTICLGSALAAPQSSCIMCDKEDLRPRLPPY
SDSYEEYTFDHQVTQQAALESIQKFNGSRGQNNACSSIKCPPNTPKYCLG
GQFINDHCWCELQHREEGLPYVPHVCFADQKVHTSSVESCFTFVQVKECC
CAEIWIKKWRHISGSSRGQHVPNVLVLLILNLLSAFSILTCRRRRRIFWQ
S*

LP13353.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG5910-PB 251 CG5910-PB 1..251 1..251 1365 100 Plus
CG5910-PA 251 CG5910-PA 1..251 1..251 1365 100 Plus

LP13353.pep Sequence

Translation from 208 to 963

> LP13353.pep
MLHMEIIQFRQRHTMWNFLDRFELDAEDRQCLERLQQPAERSTDKSFTPK
VSLRYQPAIVPSFLSIGIAVTICLGSALAAPQSSCIMCDKEDLRPRLPPY
SDSYEEYTFDHQVTQQAALESIQKFNGSRGQNNACSSIKCPPNTPKYCLG
GQFINDHCWCELQHREEGLPYVPHVCFADQKVHTSSVESCFTFVQVKECC
CAEIWIKKWRHISGSSRGQHVPNVLVLLILNLLSAFSILTCRRRRRIFWQ
S*

LP13353.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10342-PA 213 GF10342-PA 1..200 6..211 484 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16115-PA 237 GG16115-PA 1..236 15..250 1094 90.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14548-PA 201 GH14548-PA 66..199 79..210 455 61.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5910-PB 251 CG5910-PB 1..251 1..251 1365 100 Plus
CG5910-PA 251 CG5910-PA 1..251 1..251 1365 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13396-PA 205 GI13396-PA 55..198 91..233 333 47.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12788-PA 239 GL12788-PA 97..235 103..245 505 63.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19221-PA 229 GA19221-PA 1..225 15..245 669 56.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22293-PA 220 GM22293-PA 1..212 1..211 1079 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14887-PA 252 GD14887-PA 1..249 1..248 1221 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11521-PA 232 GJ11521-PA 69..232 79..246 514 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12290-PA 235 GK12290-PA 71..234 79..243 525 57.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19682-PA 237 GE19682-PA 1..237 15..251 1095 91.6 Plus
Dyak\GE19681-PA 237 GE19681-PA 1..237 15..251 1093 91.1 Plus