LP14045.complete Sequence
357 bp assembled on 2008-12-09
GenBank Submission: BT053728.1
> LP14045.complete
TTAAAGCAACAACCATGAAGCTGCTCGTTGTCGCCGTCATTGCGTGCATC
ATGCTCATCGGATTCGCCGATCCTGCCTCGGGCTGCAAGGATTGTTCATG
CGTGATTTGTGGACCTGGTGGCGAGCCGTGTCCTGGGTGTTCCGCACGGG
TTCCCGTCTGCAAAGATCTGATCAACATTATGGAGGGTCTTGAGCGGCAG
GTGCGTCAGTGCGCCTGCGGAGAGCAGGTTTGGCTGTTCTAGAGATGTGC
CCTCAACCTAATCGGCACTGACCTTTTATCTGCTGGCATTTAAAACTGCT
GTCTAATAAAACTATTATCATTCCTGCACGACCCAAAAAAAAAAAAAAAA
AAAAAAA
LP14045.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:14:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-RA | 375 | Sgs8-RA | 38..374 | 1..337 | 1685 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:06:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 11499843..11500135 | 334..42 | 1420 | 99 | Minus |
chr3L | 24539361 | chr3L | 11500204..11500245 | 42..1 | 210 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 11508964..11509259 | 337..42 | 1480 | 100 | Minus |
3L | 28110227 | 3L | 11509328..11509369 | 42..1 | 210 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 11502064..11502359 | 337..42 | 1480 | 100 | Minus |
3L | 28103327 | 3L | 11502428..11502469 | 42..1 | 210 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 21:06:09 has no hits.
LP14045.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:07:05 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 11499843..11500134 | 43..334 | 98 | <- | Minus |
chr3L | 11500204..11500245 | 1..42 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:57 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 1..228 | 15..242 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:54 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 1..228 | 15..242 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:01 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 1..228 | 15..242 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:56 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 1..228 | 15..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 18:37:45 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 26..359 | 1..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:54 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 26..359 | 1..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:01 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 26..359 | 1..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:56 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sgs8-RA | 26..359 | 1..334 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11508967..11509258 | 43..334 | 100 | <- | Minus |
3L | 11509328..11509369 | 1..42 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11508967..11509258 | 43..334 | 100 | <- | Minus |
3L | 11509328..11509369 | 1..42 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11508967..11509258 | 43..334 | 100 | <- | Minus |
3L | 11509328..11509369 | 1..42 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:01 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 11502067..11502358 | 43..334 | 100 | <- | Minus |
arm_3L | 11502428..11502469 | 1..42 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:34 Download gff for
LP14045.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11502067..11502358 | 43..334 | 100 | <- | Minus |
3L | 11502428..11502469 | 1..42 | 100 | | Minus |
LP14045.pep Sequence
Translation from 2 to 241
> LP14045.pep
KATTMKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARV
PVCKDLINIMEGLERQVRQCACGEQVWLF*
LP14045.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25269-PA | 73 | GF25269-PA | 1..71 | 5..79 | 140 | 40 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\Sgs8-PA | 75 | GG15509-PA | 1..75 | 5..79 | 234 | 64 | Plus |
Dere\GG13918-PA | 78 | GG13918-PA | 1..78 | 5..79 | 190 | 50 | Plus |
Dere\Sgs3-PA | 333 | GG15510-PA | 276..333 | 20..79 | 178 | 56.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-PA | 75 | CG6132-PA | 1..75 | 5..79 | 416 | 100 | Plus |
Sgs7-PA | 74 | CG18087-PA | 1..73 | 5..78 | 203 | 47.3 | Plus |
Sgs3-PA | 307 | CG11720-PA | 257..306 | 29..78 | 179 | 56 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL22823-PA | 236 | GL22823-PA | 189..236 | 32..79 | 136 | 47.9 | Plus |
Dper\GL22801-PA | 257 | GL22801-PA | 210..257 | 32..79 | 134 | 50 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23426-PA | 229 | GA23426-PA | 182..229 | 32..79 | 133 | 50 | Plus |
Dpse\GA23878-PA | 224 | GA23878-PA | 177..224 | 32..79 | 132 | 47.9 | Plus |
Dpse\GA23425-PA | 207 | GA23425-PA | 160..207 | 32..79 | 131 | 47.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24748-PA | 74 | GM24748-PA | 1..74 | 5..77 | 260 | 68.9 | Plus |
Dsec\GM25278-PA | 74 | GM25278-PA | 1..74 | 5..79 | 183 | 46.7 | Plus |
Dsec\GM25279-PA | 139 | GM25279-PA | 89..139 | 29..79 | 161 | 56.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17634-PA | 74 | GD17634-PA | 1..74 | 5..79 | 192 | 50.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\Sgs8-PA | 76 | GE21817-PA | 1..76 | 5..79 | 241 | 61.8 | Plus |
Dyak\GE20214-PA | 74 | GE20214-PA | 1..74 | 5..79 | 135 | 50.7 | Plus |
Dyak\Sgs3-PA | 273 | GE21820-PA | 225..273 | 31..79 | 135 | 51 | Plus |
Dyak\GE21818-PA | 74 | GE21818-PA | 16..74 | 20..79 | 131 | 46.7 | Plus |
LP14045.hyp Sequence
Translation from 2 to 241
> LP14045.hyp
KATTMKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARV
PVCKDLINIMEGLERQVRQCACGEQVWLF*
LP14045.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sgs8-PA | 75 | CG6132-PA | 1..75 | 5..79 | 416 | 100 | Plus |
Sgs7-PA | 74 | CG18087-PA | 1..73 | 5..78 | 203 | 47.3 | Plus |
Sgs3-PA | 307 | CG11720-PA | 257..306 | 29..78 | 179 | 56 | Plus |