Clone LP14045 Report

Search the DGRC for LP14045

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:45
Vector:pOT2
Associated Gene/TranscriptSgs8-RA
Protein status:LP14045.pep: gold
Sequenced Size:357

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Sgs8 2008-12-18 5.12 accounting

Clone Sequence Records

LP14045.complete Sequence

357 bp assembled on 2008-12-09

GenBank Submission: BT053728.1

> LP14045.complete
TTAAAGCAACAACCATGAAGCTGCTCGTTGTCGCCGTCATTGCGTGCATC
ATGCTCATCGGATTCGCCGATCCTGCCTCGGGCTGCAAGGATTGTTCATG
CGTGATTTGTGGACCTGGTGGCGAGCCGTGTCCTGGGTGTTCCGCACGGG
TTCCCGTCTGCAAAGATCTGATCAACATTATGGAGGGTCTTGAGCGGCAG
GTGCGTCAGTGCGCCTGCGGAGAGCAGGTTTGGCTGTTCTAGAGATGTGC
CCTCAACCTAATCGGCACTGACCTTTTATCTGCTGGCATTTAAAACTGCT
GTCTAATAAAACTATTATCATTCCTGCACGACCCAAAAAAAAAAAAAAAA
AAAAAAA

LP14045.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-RA 375 Sgs8-RA 38..374 1..337 1685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11499843..11500135 334..42 1420 99 Minus
chr3L 24539361 chr3L 11500204..11500245 42..1 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11508964..11509259 337..42 1480 100 Minus
3L 28110227 3L 11509328..11509369 42..1 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11502064..11502359 337..42 1480 100 Minus
3L 28103327 3L 11502428..11502469 42..1 210 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:06:09 has no hits.

LP14045.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:07:05 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11499843..11500134 43..334 98 <- Minus
chr3L 11500204..11500245 1..42 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:57 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 1..228 15..242 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:54 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 1..228 15..242 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:01 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 1..228 15..242 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:56 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 1..228 15..242 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 18:37:45 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 26..359 1..334 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:54 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 26..359 1..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:01 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 26..359 1..334 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:56 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
Sgs8-RA 26..359 1..334 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11508967..11509258 43..334 100 <- Minus
3L 11509328..11509369 1..42 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11508967..11509258 43..334 100 <- Minus
3L 11509328..11509369 1..42 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:05 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11508967..11509258 43..334 100 <- Minus
3L 11509328..11509369 1..42 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:01 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11502067..11502358 43..334 100 <- Minus
arm_3L 11502428..11502469 1..42 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:34 Download gff for LP14045.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11502067..11502358 43..334 100 <- Minus
3L 11502428..11502469 1..42 100   Minus

LP14045.pep Sequence

Translation from 2 to 241

> LP14045.pep
KATTMKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARV
PVCKDLINIMEGLERQVRQCACGEQVWLF*

LP14045.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25269-PA 73 GF25269-PA 1..71 5..79 140 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Sgs8-PA 75 GG15509-PA 1..75 5..79 234 64 Plus
Dere\GG13918-PA 78 GG13918-PA 1..78 5..79 190 50 Plus
Dere\Sgs3-PA 333 GG15510-PA 276..333 20..79 178 56.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-PA 75 CG6132-PA 1..75 5..79 416 100 Plus
Sgs7-PA 74 CG18087-PA 1..73 5..78 203 47.3 Plus
Sgs3-PA 307 CG11720-PA 257..306 29..78 179 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22823-PA 236 GL22823-PA 189..236 32..79 136 47.9 Plus
Dper\GL22801-PA 257 GL22801-PA 210..257 32..79 134 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23426-PA 229 GA23426-PA 182..229 32..79 133 50 Plus
Dpse\GA23878-PA 224 GA23878-PA 177..224 32..79 132 47.9 Plus
Dpse\GA23425-PA 207 GA23425-PA 160..207 32..79 131 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24748-PA 74 GM24748-PA 1..74 5..77 260 68.9 Plus
Dsec\GM25278-PA 74 GM25278-PA 1..74 5..79 183 46.7 Plus
Dsec\GM25279-PA 139 GM25279-PA 89..139 29..79 161 56.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17634-PA 74 GD17634-PA 1..74 5..79 192 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Sgs8-PA 76 GE21817-PA 1..76 5..79 241 61.8 Plus
Dyak\GE20214-PA 74 GE20214-PA 1..74 5..79 135 50.7 Plus
Dyak\Sgs3-PA 273 GE21820-PA 225..273 31..79 135 51 Plus
Dyak\GE21818-PA 74 GE21818-PA 16..74 20..79 131 46.7 Plus

LP14045.hyp Sequence

Translation from 2 to 241

> LP14045.hyp
KATTMKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARV
PVCKDLINIMEGLERQVRQCACGEQVWLF*

LP14045.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sgs8-PA 75 CG6132-PA 1..75 5..79 416 100 Plus
Sgs7-PA 74 CG18087-PA 1..73 5..78 203 47.3 Plus
Sgs3-PA 307 CG11720-PA 257..306 29..78 179 56 Plus