Clone LP14056 Report

Search the DGRC for LP14056

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:56
Vector:pOT2
Associated Gene/TranscriptCG1667-RB
Protein status:LP14056.pep: gold
Sequenced Size:1579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1667 2003-01-01 Sim4 clustering to Release 3
CG1667 2004-07-13 Blastp of sequenced clone
CG1667 2008-04-29 Release 5.5 accounting
CG1667 2008-08-15 Release 5.9 accounting
CG1667 2008-12-18 5.12 accounting

Clone Sequence Records

LP14056.complete Sequence

1579 bp (1579 high quality bases) assembled on 2004-07-13

GenBank Submission: BT015254

> LP14056.complete
ATCAGTTCATCCAGTTGAGATTCTTCTCCCCGGACAAAGAATTTTCCATT
AAAGTAAATTTAAATTAATAGCGTTCCCAAGCTTTTGCTCCTGAGATCTT
TGAGCCTGGATCCATTCGTTTTGACAGAAAAAACCGCAGCGAAGTTTTCG
CGAGATCTCCAAATCGATCTGGCAACCCTTGAGACGTACATATGTATGCA
GACGAAATGGCAATCGCTAGCAACGTTGTCGAAGCGGGGAACGCGGTTCG
CGCGGAAAAAGGCAGAAAATATTTTTATTTTCGAAAGATGATAGGAGATT
ATATTGACACCTCTATTCGCATTGTAGCCACCGTGTTCTTGGCTGATCTG
CTCCTTCGCTTGTACCGCTGTGTCGTCGAATATGGGAGCAATGGGCGGTA
CTATTTGCCCGAGGATCGGCTGTGGATAATCCTGCGGCGCTCGTGCACGT
ATAACAACAGATCGATATACCTGATTGTGGGATTCCTTCTCGTAGCTTTT
TTTCGAATTTCGGTTACCGGGAATTACAGGAACGTAATGCCCACGACGCT
GTTTCTGTTCCAAATGCCGCTCTACTGGATATGGAGCTTTACCGATATGG
ACCAAAGCACCCTGAGCTACTCGCACTGGATACGTGACTCCCATGGACTA
GACTATGCGGCCGGAATGGCCTCCAACTACTTTCACGGCTACCTCAAACT
TTCACTGCCCGAACGCAAGGATGATGGGCTCAAACATCGATTAGCAATGT
ACGAGGACAAGAATAATGTTACCTTCGGCATTAAACGACTGGTTATCCTC
ATTCCCGATGAGATGTTTGTCAACGGCGTACTAGAAAGCCACTTACTTGA
CAAAGCTGAGCCCCTGGAGACCCAGTTCATCAACCGAGCCGGTGTCTATC
GTCCTTTCAAGCACGATGTCTACAGAATGAACAAAAAGGTCAATGGCAGG
ACCTATTACTTTGCCGTCGAGGGTGCCACGCCCATGATATCCTTCTTCGA
TGCGACGTACTCTAACTTGTCGGGTACCTGGCAGATGCAGGAACTAAAGC
GAGAGATCTGGATCAAGTTCTACAAGCACCTGAAAGAACTTATTACTACT
TGGCCGGAGACTCGAGACCTTGTAGAGCTCATCATCTATAACTCCCATGA
TAGCAAGGGCAACCTGGTGGATGTTGGCGAATTGCTTGTAGCTCATATGC
AAAACAAAACCAAAACTATTGACGAAATTTCCAACTAAGACTTGAAATCA
AAAACGATTCCAAAGATTACGTTTTTTAATAATATATATCTATATATTGT
AGTAATACCAAATTATTCTAGTTTCATAGATTCATAAAATTGTTTGTGAT
TAAACACAAACAAAAGACTATAAAGCCCTAACCATTTTATCGCGAAACAC
ATCGCCAGTTAGCCACACAAACACCAGTTGTTTCAGTTGTCCCTTGGGCA
TATTAATATCTCTGAAAATTGATGCAAATTTTAATTGTAATGCGCTCTTT
GTTTTACTTAAAACTAATAAGAATGTTCAGTTTAATAAATAAGTTATATA
ATAAGTAATTAAAAAAAAAAAAAAAAAAA

LP14056.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1667-RA 1609 CG1667-RA 48..1609 1..1562 7810 100 Plus
Orc6-RA 1066 Orc6-RA 988..1066 1562..1484 395 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5731435..5731885 306..756 2225 99.6 Plus
chr2R 21145070 chr2R 5732096..5732380 859..1143 1410 99.6 Plus
chr2R 21145070 chr2R 5732466..5732697 1144..1375 1145 99.6 Plus
chr2R 21145070 chr2R 5732805..5732991 1374..1560 920 99.5 Plus
chr2R 21145070 chr2R 5731210..5731379 137..306 790 97.6 Plus
chr2R 21145070 chr2R 5730178..5730316 1..139 695 100 Plus
chr2R 21145070 chr2R 5731935..5732041 754..860 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9843959..9844409 306..756 2255 100 Plus
2R 25286936 2R 9844620..9844904 859..1143 1425 100 Plus
2R 25286936 2R 9844990..9845221 1144..1375 1160 100 Plus
2R 25286936 2R 9845326..9845514 1374..1562 945 100 Plus
2R 25286936 2R 9843734..9843903 137..306 850 100 Plus
2R 25286936 2R 9842702..9842840 1..139 695 100 Plus
2R 25286936 2R 9844459..9844565 754..860 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9845158..9845608 306..756 2255 100 Plus
2R 25260384 2R 9845819..9846103 859..1143 1425 100 Plus
2R 25260384 2R 9846189..9846420 1144..1375 1160 100 Plus
2R 25260384 2R 9846525..9846713 1374..1562 945 100 Plus
2R 25260384 2R 9844933..9845102 137..306 850 100 Plus
2R 25260384 2R 9843901..9844039 1..139 695 100 Plus
2R 25260384 2R 9845658..9845764 754..860 535 100 Plus
Blast to na_te.dros performed 2019-03-15 13:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 1875..1973 1552..1454 125 61 Minus
Juan 4236 Juan JUAN 4236bp 3950..4019 1294..1222 123 67.1 Minus

LP14056.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:00:03 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5730178..5730316 1..139 100 -> Plus
chr2R 5731213..5731379 140..306 97 -> Plus
chr2R 5731436..5731884 307..755 99 -> Plus
chr2R 5731937..5732041 756..860 100 -> Plus
chr2R 5732098..5732380 861..1143 99 -> Plus
chr2R 5732466..5732697 1144..1375 99 -> Plus
chr2R 5732807..5732991 1376..1560 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:34 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 1..1047 192..1238 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:35:31 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 1..1047 192..1238 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:20:14 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 1..1047 192..1238 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:19:22 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 1..1047 192..1238 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:48:20 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RB 1..1032 207..1238 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:42:16 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 5..1564 1..1560 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:35:31 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 16..1575 1..1560 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:20:14 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 17..1576 1..1560 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:19:23 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RA 5..1564 1..1560 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:48:20 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
CG1667-RC 17..1576 1..1560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:03 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9842702..9842840 1..139 100 -> Plus
2R 9843737..9843903 140..306 100 -> Plus
2R 9843960..9844408 307..755 100 -> Plus
2R 9844461..9844565 756..860 100 -> Plus
2R 9844622..9844904 861..1143 100 -> Plus
2R 9844990..9845221 1144..1375 100 -> Plus
2R 9845328..9845512 1376..1560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:03 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9842702..9842840 1..139 100 -> Plus
2R 9843737..9843903 140..306 100 -> Plus
2R 9843960..9844408 307..755 100 -> Plus
2R 9844461..9844565 756..860 100 -> Plus
2R 9844622..9844904 861..1143 100 -> Plus
2R 9844990..9845221 1144..1375 100 -> Plus
2R 9845328..9845512 1376..1560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:00:03 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9842702..9842840 1..139 100 -> Plus
2R 9843737..9843903 140..306 100 -> Plus
2R 9843960..9844408 307..755 100 -> Plus
2R 9844461..9844565 756..860 100 -> Plus
2R 9844622..9844904 861..1143 100 -> Plus
2R 9844990..9845221 1144..1375 100 -> Plus
2R 9845328..9845512 1376..1560 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:20:14 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5732495..5732726 1144..1375 100 -> Plus
arm_2R 5732833..5733017 1376..1560 100   Plus
arm_2R 5730207..5730345 1..139 100 -> Plus
arm_2R 5731242..5731408 140..306 100 -> Plus
arm_2R 5731465..5731913 307..755 100 -> Plus
arm_2R 5731966..5732070 756..860 100 -> Plus
arm_2R 5732127..5732409 861..1143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:56:36 Download gff for LP14056.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9845660..9845764 756..860 100 -> Plus
2R 9845821..9846103 861..1143 100 -> Plus
2R 9846189..9846420 1144..1375 100 -> Plus
2R 9846527..9846711 1376..1560 100   Plus
2R 9845159..9845607 307..755 100 -> Plus
2R 9843901..9844039 1..139 100 -> Plus
2R 9844936..9845102 140..306 100 -> Plus

LP14056.pep Sequence

Translation from 191 to 1237

> LP14056.pep
MYADEMAIASNVVEAGNAVRAEKGRKYFYFRKMIGDYIDTSIRIVATVFL
ADLLLRLYRCVVEYGSNGRYYLPEDRLWIILRRSCTYNNRSIYLIVGFLL
VAFFRISVTGNYRNVMPTTLFLFQMPLYWIWSFTDMDQSTLSYSHWIRDS
HGLDYAAGMASNYFHGYLKLSLPERKDDGLKHRLAMYEDKNNVTFGIKRL
VILIPDEMFVNGVLESHLLDKAEPLETQFINRAGVYRPFKHDVYRMNKKV
NGRTYYFAVEGATPMISFFDATYSNLSGTWQMQELKREIWIKFYKHLKEL
ITTWPETRDLVELIIYNSHDSKGNLVDVGELLVAHMQNKTKTIDEISN*

LP14056.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11767-PA 321 GF11767-PA 1..316 33..348 1249 70.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24109-PA 344 GG24109-PA 1..344 6..348 1570 82.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23281-PA 311 GH23281-PA 1..304 33..336 1015 58.9 Plus
Dgri\GH20561-PA 311 GH20561-PA 1..304 33..336 1015 58.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sting-PC 343 CG1667-PC 1..343 6..348 1810 100 Plus
Sting-PB 343 CG1667-PB 1..343 6..348 1810 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18829-PA 313 GI18829-PA 4..303 37..336 1005 60.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10095-PA 311 GL10095-PA 1..308 33..341 1152 64.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14087-PB 336 GA14087-PB 6..333 14..343 1156 61.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24406-PA 316 GM24406-PA 1..316 33..348 1582 91.5 Plus
Dsec\GM21157-PA 316 GM21157-PA 1..316 33..348 1582 91.5 Plus
Dsec\GM21158-PA 220 GM21158-PA 1..217 114..330 1099 91.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10689-PA 316 GD10689-PA 1..316 33..348 1582 91.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21856-PA 333 GJ21856-PA 2..329 18..339 1022 57.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20640-PA 313 GK20640-PA 1..313 33..344 1024 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19307-PA 347 GE19307-PA 5..347 6..348 1593 85.1 Plus

LP14056.hyp Sequence

Translation from 191 to 1237

> LP14056.hyp
MYADEMAIASNVVEAGNAVRAEKGRKYFYFRKMIGDYIDTSIRIVATVFL
ADLLLRLYRCVVEYGSNGRYYLPEDRLWIILRRSCTYNNRSIYLIVGFLL
VAFFRISVTGNYRNVMPTTLFLFQMPLYWIWSFTDMDQSTLSYSHWIRDS
HGLDYAAGMASNYFHGYLKLSLPERKDDGLKHRLAMYEDKNNVTFGIKRL
VILIPDEMFVNGVLESHLLDKAEPLETQFINRAGVYRPFKHDVYRMNKKV
NGRTYYFAVEGATPMISFFDATYSNLSGTWQMQELKREIWIKFYKHLKEL
ITTWPETRDLVELIIYNSHDSKGNLVDVGELLVAHMQNKTKTIDEISN*

LP14056.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG1667-PC 343 CG1667-PC 1..343 6..348 1810 100 Plus
CG1667-PB 343 CG1667-PB 1..343 6..348 1810 100 Plus