Clone LP14077 Report

Search the DGRC for LP14077

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:77
Vector:pOT2
Associated Gene/TranscriptRpL3-RA
Protein status:LP14077.pep: gold
Sequenced Size:1385

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL3-RA 2008-12-09 Manual selection by Sue Celniker

Clone Sequence Records

LP14077.complete Sequence

1385 bp assembled on 2009-07-24

GenBank Submission: BT088948.1

> LP14077.complete
GAACAGACATGTCTCATCGTAAGTTCTCGGCACCCCGCCATGGCTCCATG
GCCTTCTACCCCAAGAAGCGCTCAGCTCGCCATCGCGGTAAGGTTAAGGC
CTTCCCCAAGGATGACGCCAGCAAGCCAGTCCATCTGACCTGCTTCATCG
GCTACAAGGCCGGCATGACCCACATTGTGCGCGAGGCCGATCGTCCTGGC
TCCAAGATCAACAAGAAGGAGGTGGTCGAGGCCGTCACCGTTCTGGAGAC
CCCGCCCATGATTGTGGTCGGTGCTGTCGGCTACATCGAGACTCCCTTCG
GTCTGCGTGCCCTGGTCAACGTTTGGGCCCAGCATCTCTCCGAGGAGTGC
CGTCGTCGCTTCTACAAGAACTGGTACAAGAGCAAGAAGAAGGCATTCAC
CAAGGCCAGCAAGAAGTGGACCGATGATCTCGGCAAGAAGAGCATCGAGA
ATGACTTCCGCAAGATGCTGCGCTACTGCAAGGTGATCCGTGTGATTGCC
CACTCGCAGATCCGCTTGATCAAGCAGCGCCAAAAGAAGGCCCATGTCAT
GGAGATCCAGCTGAACGGCGGCTCCATCGAGGACAAGGTCAAGTGGGCTC
GCGAGCATTTGGAGAAGCCCATCCAGGTCAGCAACGTCTTCGGCCAGGAC
GAGATGATCGACTGCGTTGGTGTGACCAAGGGTAAGGGTTTCAAGGGTGT
CACCTCGCGTTGGCACACCAAGAAGCTGCCCCGCAAGACGCACAAGGGTC
TGCGCAAGGTGGCCTGTATTGGTGCCTGGCATCCGTCGCGTGTGTCCACC
ACCGTGGCCCGTGCCGGTCAGAAGGGTTACCACCACCGTACCGAGATCAA
CAAGAAGATCTACCGCATCGGCGCTGGCATCCACACCAAGGACGGCAAGG
TCATCAAGAACAACGCCTCCACCGAGTACGATCTGACCGACAAGAGCATC
ACGCCCATGGGTGGCTTCCCCCACTACGGTGAGGTCAACAACGACTTCGT
CATGATCAAGGGCTGCTGCATCGGCTCCAAGAAGCGCATCATCACCCTGC
GCAAGTCCCTGCTGAAGCACACCAAGCGCTCTGCCCTGGAGCAGATCAAG
CTCAAGTTCATCGACACCTCGTCCAAGATGGGTCACGGTCGCTTCCAGAC
CCCTGCCGACAAGCTGGCCTTCATGGGACCGCTCAAGAAGGATCGTCTCA
AGGAGGAGGCTGCCGCTACCACCGCTGCTGCTGCCGCCGCCACCACCACC
AGTGCTTAAACAAAATGTCGTGTCCGCGTTCAATTGTCTGCTCGCTTCTA
CCACCAACTGCTGCGGTAGGGCAGCGATCAATAAACAGATTTTGGCTAAG
CTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP14077.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
RpL3-RA 1934 RpL3-RA 86..1439 1..1354 6770 100 Plus
RpL3-RB 1967 RpL3-RB 315..1658 11..1354 6720 100 Plus
RpL3-RE 1979 RpL3-RE 327..1670 11..1354 6720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7050080..7050535 898..1353 2235 99.3 Plus
chr3R 27901430 chr3R 7049447..7049840 508..901 1955 99.7 Plus
chr3R 27901430 chr3R 7047761..7047954 11..204 970 100 Plus
chr3R 27901430 chr3R 7048151..7048322 205..376 800 97.7 Plus
chr3R 27901430 chr3R 7048985..7049121 373..509 685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11224489..11224945 898..1354 2285 100 Plus
3R 32079331 3R 11223856..11224249 508..901 1970 100 Plus
3R 32079331 3R 11222174..11222367 11..204 970 100 Plus
3R 32079331 3R 11222561..11222732 205..376 860 100 Plus
3R 32079331 3R 11223394..11223530 373..509 685 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10965320..10965776 898..1354 2285 100 Plus
3R 31820162 3R 10964687..10965080 508..901 1970 100 Plus
3R 31820162 3R 10963005..10963198 11..204 970 100 Plus
3R 31820162 3R 10963392..10963563 205..376 860 100 Plus
3R 31820162 3R 10964225..10964361 373..509 685 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:26:59 has no hits.

LP14077.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:28:02 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7048986..7049121 374..509 100 -> Plus
chr3R 7047759..7047954 8..204 99 -> Plus
chr3R 7048151..7048319 205..373 97 -> Plus
chr3R 7049449..7049838 510..899 99 -> Plus
chr3R 7050082..7050535 900..1353 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:47 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 1..1251 9..1259 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:07 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 1..1251 9..1259 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:09 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 1..1251 9..1259 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:34:54 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 1..1251 9..1259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-24 15:02:00 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 27..1379 1..1353 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:07 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 29..1381 1..1353 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:09 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 29..1381 1..1353 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:34:54 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
RpL3-RA 29..1381 1..1353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:02 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11224491..11224944 900..1353 100   Plus
3R 11222172..11222367 8..204 99 -> Plus
3R 11222561..11222729 205..373 100 -> Plus
3R 11223395..11223530 374..509 100 -> Plus
3R 11223858..11224247 510..899 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:02 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11224491..11224944 900..1353 100   Plus
3R 11222172..11222367 8..204 99 -> Plus
3R 11222561..11222729 205..373 100 -> Plus
3R 11223395..11223530 374..509 100 -> Plus
3R 11223858..11224247 510..899 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:02 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11224491..11224944 900..1353 100   Plus
3R 11222172..11222367 8..204 99 -> Plus
3R 11222561..11222729 205..373 100 -> Plus
3R 11223395..11223530 374..509 100 -> Plus
3R 11223858..11224247 510..899 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:09 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7047894..7048089 8..204 99 -> Plus
arm_3R 7048283..7048451 205..373 100 -> Plus
arm_3R 7049117..7049252 374..509 100 -> Plus
arm_3R 7049580..7049969 510..899 100 -> Plus
arm_3R 7050213..7050666 900..1353 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:50 Download gff for LP14077.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10964689..10965078 510..899 100 -> Plus
3R 10965322..10965775 900..1353 100   Plus
3R 10963003..10963198 8..204 99 -> Plus
3R 10963392..10963560 205..373 100 -> Plus
3R 10964226..10964361 374..509 100 -> Plus

LP14077.pep Sequence

Translation from 2 to 1258

> LP14077.pep
TDMSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIG
YKAGMTHIVREADRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFG
LRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKASKKWTDDLGKKSIEN
DFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQLNGGSIEDKVKWAR
EHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKLPRKTHKGL
RKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKV
IKNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLR
KSLLKHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLKKDRLK
EEAAATTAAAAAATTTSA*

LP14077.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16740-PA 415 GF16740-PA 1..415 3..417 2185 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17978-PA 416 GG17978-PA 1..416 3..418 2201 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14923-PA 417 GH14923-PA 1..417 3..418 2169 96.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpL3-PH 416 CG4863-PH 1..416 3..418 2187 100 Plus
RpL3-PA 416 CG4863-PA 1..416 3..418 2187 100 Plus
RpL3-PD 161 CG4863-PD 1..126 3..128 662 98.4 Plus
RpL3-PG 138 CG4863-PG 1..121 3..123 641 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23698-PA 415 GI23698-PA 1..414 3..415 2168 97.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12566-PA 415 GL12566-PA 1..415 3..417 2192 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18487-PA 412 GA18487-PA 1..397 3..402 2047 96 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23925-PA 611 GM23925-PA 1..298 3..300 1601 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18739-PA 416 GD18739-PA 1..416 3..418 2222 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23255-PA 415 GJ23255-PA 1..415 3..417 2165 96.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14309-PA 414 GK14309-PA 1..413 3..415 2187 98.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26079-PA 416 GE26079-PA 1..416 3..418 2221 99.8 Plus

LP14077.hyp Sequence

Translation from 8 to 1258

> LP14077.hyp
QSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYK
AGMTHIVREADRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLR
ALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKASKKWTDDLGKKSIENDF
RKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQLNGGSIEDKVKWAREH
LEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKLPRKTHKGLRK
VACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIK
NNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKS
LLKHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLKKDRLKEE
AAATTAAAAAATTTSA*

LP14077.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
RpL3-PH 416 CG4863-PH 2..416 2..416 2182 100 Plus
RpL3-PA 416 CG4863-PA 2..416 2..416 2182 100 Plus
RpL3-PD 161 CG4863-PD 2..126 2..126 657 98.4 Plus
RpL3-PG 138 CG4863-PG 2..121 2..121 636 100 Plus