LP14083.complete Sequence
342 bp assembled on 2008-12-10
GenBank Submission: BT053729.1
> LP14083.complete
CGGAACATCAGTTGCAATGGTGCAGATCAAATTCCTTTTCGTCTTCCTGG
CTGTGATGACAATTGTTGTCCTGGCCGCCAATATGGCTGATGCCGATTGC
CTTTCCGGCAAATACAAGGGTCCCTGCGCCGTCTGGGACAACGAGATGTG
CCGACGTATTTGCAAGGAGGAGGGACATATCAGTGGCCACTGCAGTCCCA
GCCTGAAGTGCTGGTGCGAAGGATGCTGAATCCATACTATATCCATTTGA
AATGTGTATATTGAATATTTCATTCTAAACAAATAATATATAAATATAAA
GGCCTCTTACGCTTATCACTCATAAAAAAAAAAAAAAAAAAA
LP14083.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:15:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
dro2-RA | 334 | dro2-RA | 11..334 | 1..324 | 1620 | 100 | Plus |
nc_10374.a | 397 | nc_10374.a | 177..397 | 274..54 | 1105 | 100 | Minus |
Drs-RA | 376 | Drs-RA | 51..269 | 17..235 | 495 | 81.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:45:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3313767..3314089 | 1..323 | 1600 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 3369043..3369261 | 17..235 | 495 | 81.7 | Plus |
chr3L | 24539361 | chr3L | 3316242..3316448 | 21..227 | 450 | 81.2 | Plus |
chr3L | 24539361 | chr3L | 3335582..3335803 | 231..16 | 310 | 77 | Minus |
chr3L | 24539361 | chr3L | 3315177..3315258 | 148..229 | 230 | 85.4 | Plus |
chr3L | 24539361 | chr3L | 3314577..3314663 | 148..234 | 225 | 83.9 | Plus |
chr3L | 24539361 | chr3L | 3335021..3335158 | 227..90 | 210 | 76.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3314359..3314682 | 1..324 | 1620 | 100 | Plus |
3L | 28110227 | 3L | 3369619..3369837 | 17..235 | 495 | 81.7 | Plus |
3L | 28110227 | 3L | 3316836..3317042 | 21..227 | 450 | 81.2 | Plus |
3L | 28110227 | 3L | 3336142..3336363 | 231..16 | 310 | 77 | Minus |
3L | 28110227 | 3L | 3315771..3315852 | 148..229 | 215 | 84.1 | Plus |
3L | 28110227 | 3L | 3315168..3315254 | 148..234 | 210 | 82.8 | Plus |
3L | 28110227 | 3L | 3335581..3335718 | 227..90 | 210 | 76.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3314359..3314682 | 1..324 | 1620 | 100 | Plus |
3L | 28103327 | 3L | 3369619..3369837 | 17..235 | 495 | 81.7 | Plus |
3L | 28103327 | 3L | 3316836..3317042 | 21..227 | 450 | 81.1 | Plus |
3L | 28103327 | 3L | 3336203..3336363 | 176..16 | 265 | 77.6 | Minus |
3L | 28103327 | 3L | 3315771..3315852 | 148..229 | 215 | 84.1 | Plus |
3L | 28103327 | 3L | 3315168..3315254 | 148..234 | 210 | 82.7 | Plus |
3L | 28103327 | 3L | 3336142..3336191 | 231..182 | 175 | 90 | Minus |
3L | 28103327 | 3L | 3335581..3335627 | 227..181 | 160 | 89.3 | Minus |
3L | 28103327 | 3L | 3315021..3315083 | 4..66 | 135 | 80.9 | Plus |
Blast to na_te.dros performed 2019-03-16 21:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3437..3482 | 186..231 | 104 | 69.6 | Plus |
LP14083.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:45:38 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3313767..3314089 | 1..323 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:02 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro2-RA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:03 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro2-RA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:14 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl2-RA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:05 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl2-RA | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 16:41:26 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro2-RA | 11..333 | 1..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:03 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro2-RA | 11..333 | 1..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:14 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl2-RA | 11..333 | 1..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:05 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl2-RA | 11..333 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314359..3314681 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314359..3314681 | 1..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314359..3314681 | 1..323 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:14 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3314359..3314681 | 1..323 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:45 Download gff for
LP14083.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3314359..3314681 | 1..323 | 100 | | Plus |
LP14083.hyp Sequence
Translation from 0 to 228
> LP14083.hyp
GTSVAMVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMC
RRICKEEGHISGHCSPSLKCWCEGC*
LP14083.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 6..75 | 394 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 6..75 | 328 | 78.6 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 7..75 | 326 | 79.7 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 6..75 | 299 | 69.4 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 6..75 | 263 | 64.8 | Plus |
LP14083.pep Sequence
Translation from 1 to 228
> LP14083.pep
GTSVAMVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMC
RRICKEEGHISGHCSPSLKCWCEGC*
LP14083.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 7..75 | 298 | 76.8 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 7..75 | 294 | 75.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15126-PA | 70 | GG15126-PA | 1..70 | 6..75 | 330 | 90 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 1..70 | 6..75 | 307 | 77.1 | Plus |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 7..75 | 303 | 78.3 | Plus |
Dere\GG14261-PA | 72 | GG14261-PA | 1..72 | 6..75 | 274 | 68.1 | Plus |
Dere\GG15127-PA | 71 | GG15127-PA | 1..71 | 6..75 | 260 | 66.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl2-PA | 70 | CG32279-PA | 1..70 | 6..75 | 394 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 1..70 | 6..75 | 328 | 78.6 | Plus |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 7..75 | 326 | 79.7 | Plus |
Drsl6-PA | 72 | CG32268-PA | 1..72 | 6..75 | 299 | 69.4 | Plus |
Drsl4-PA | 71 | CG32282-PA | 1..71 | 6..75 | 263 | 64.8 | Plus |
Drsl3-PA | 71 | CG32283-PA | 1..71 | 6..75 | 260 | 64.8 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 7..75 | 249 | 60.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14560-PA | 70 | GM14560-PA | 1..70 | 6..75 | 368 | 98.6 | Plus |
Dsec\GM14569-PA | 72 | GM14569-PA | 1..70 | 6..75 | 305 | 77.1 | Plus |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 7..75 | 301 | 78.3 | Plus |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 7..75 | 240 | 60.9 | Plus |
Dsec\GM14561-PA | 71 | GM14561-PA | 1..71 | 6..75 | 237 | 64.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Drs-PA | 70 | GD13760-PA | 1..70 | 6..75 | 310 | 78.6 | Plus |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 7..75 | 308 | 79.7 | Plus |
Dsim\dro3-PA | 71 | GD13752-PA | 1..71 | 6..75 | 251 | 66.2 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 1..71 | 6..75 | 246 | 64.8 | Plus |
Dsim\dro2-PA | 89 | GD13751-PA | 32..83 | 2..53 | 241 | 88.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21352-PA | 70 | GE21352-PA | 1..70 | 6..75 | 351 | 94.3 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 1..70 | 6..75 | 310 | 78.6 | Plus |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 7..75 | 298 | 76.8 | Plus |
Dyak\GE20688-PA | 72 | GE20688-PA | 1..72 | 6..75 | 282 | 68.1 | Plus |
Dyak\GE21353-PA | 71 | GE21353-PA | 1..71 | 6..75 | 248 | 64.8 | Plus |