Clone LP14083 Report

Search the DGRC for LP14083

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:83
Vector:pOT2
Associated Gene/TranscriptDrsl2-RA
Protein status:LP14083.pep: gold
Sequenced Size:342

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dro2 2008-12-18 5.12 accounting

Clone Sequence Records

LP14083.complete Sequence

342 bp assembled on 2008-12-10

GenBank Submission: BT053729.1

> LP14083.complete
CGGAACATCAGTTGCAATGGTGCAGATCAAATTCCTTTTCGTCTTCCTGG
CTGTGATGACAATTGTTGTCCTGGCCGCCAATATGGCTGATGCCGATTGC
CTTTCCGGCAAATACAAGGGTCCCTGCGCCGTCTGGGACAACGAGATGTG
CCGACGTATTTGCAAGGAGGAGGGACATATCAGTGGCCACTGCAGTCCCA
GCCTGAAGTGCTGGTGCGAAGGATGCTGAATCCATACTATATCCATTTGA
AATGTGTATATTGAATATTTCATTCTAAACAAATAATATATAAATATAAA
GGCCTCTTACGCTTATCACTCATAAAAAAAAAAAAAAAAAAA

LP14083.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
dro2-RA 334 dro2-RA 11..334 1..324 1620 100 Plus
nc_10374.a 397 nc_10374.a 177..397 274..54 1105 100 Minus
Drs-RA 376 Drs-RA 51..269 17..235 495 81.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3313767..3314089 1..323 1600 99.7 Plus
chr3L 24539361 chr3L 3369043..3369261 17..235 495 81.7 Plus
chr3L 24539361 chr3L 3316242..3316448 21..227 450 81.2 Plus
chr3L 24539361 chr3L 3335582..3335803 231..16 310 77 Minus
chr3L 24539361 chr3L 3315177..3315258 148..229 230 85.4 Plus
chr3L 24539361 chr3L 3314577..3314663 148..234 225 83.9 Plus
chr3L 24539361 chr3L 3335021..3335158 227..90 210 76.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3314359..3314682 1..324 1620 100 Plus
3L 28110227 3L 3369619..3369837 17..235 495 81.7 Plus
3L 28110227 3L 3316836..3317042 21..227 450 81.2 Plus
3L 28110227 3L 3336142..3336363 231..16 310 77 Minus
3L 28110227 3L 3315771..3315852 148..229 215 84.1 Plus
3L 28110227 3L 3315168..3315254 148..234 210 82.8 Plus
3L 28110227 3L 3335581..3335718 227..90 210 76.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3314359..3314682 1..324 1620 100 Plus
3L 28103327 3L 3369619..3369837 17..235 495 81.7 Plus
3L 28103327 3L 3316836..3317042 21..227 450 81.1 Plus
3L 28103327 3L 3336203..3336363 176..16 265 77.6 Minus
3L 28103327 3L 3315771..3315852 148..229 215 84.1 Plus
3L 28103327 3L 3315168..3315254 148..234 210 82.7 Plus
3L 28103327 3L 3336142..3336191 231..182 175 90 Minus
3L 28103327 3L 3335581..3335627 227..181 160 89.3 Minus
3L 28103327 3L 3315021..3315083 4..66 135 80.9 Plus
Blast to na_te.dros performed 2019-03-16 21:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3437..3482 186..231 104 69.6 Plus

LP14083.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:45:38 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3313767..3314089 1..323 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:02 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
dro2-RA 1..213 17..229 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:03 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
dro2-RA 1..213 17..229 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:14 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl2-RA 1..213 17..229 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:05 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl2-RA 1..213 17..229 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 16:41:26 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
dro2-RA 11..333 1..323 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:03 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
dro2-RA 11..333 1..323 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:14 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl2-RA 11..333 1..323 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:05 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl2-RA 11..333 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314359..3314681 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314359..3314681 1..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:45:38 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314359..3314681 1..323 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:14 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3314359..3314681 1..323 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:45 Download gff for LP14083.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3314359..3314681 1..323 100   Plus

LP14083.hyp Sequence

Translation from 0 to 228

> LP14083.hyp
GTSVAMVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMC
RRICKEEGHISGHCSPSLKCWCEGC*

LP14083.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl2-PA 70 CG32279-PA 1..70 6..75 394 100 Plus
Drs-PA 70 CG10810-PA 1..70 6..75 328 78.6 Plus
Drsl5-PA 69 CG10812-PA 1..69 7..75 326 79.7 Plus
Drsl6-PA 72 CG32268-PA 1..72 6..75 299 69.4 Plus
Drsl4-PA 71 CG32282-PA 1..71 6..75 263 64.8 Plus

LP14083.pep Sequence

Translation from 1 to 228

> LP14083.pep
GTSVAMVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMC
RRICKEEGHISGHCSPSLKCWCEGC*

LP14083.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 1..69 7..75 298 76.8 Plus
Dana\GF10208-PA 69 GF10208-PA 1..69 7..75 294 75.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15126-PA 70 GG15126-PA 1..70 6..75 330 90 Plus
Dere\GG15135-PA 70 GG15135-PA 1..70 6..75 307 77.1 Plus
Dere\GG15129-PA 69 GG15129-PA 1..69 7..75 303 78.3 Plus
Dere\GG14261-PA 72 GG14261-PA 1..72 6..75 274 68.1 Plus
Dere\GG15127-PA 71 GG15127-PA 1..71 6..75 260 66.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl2-PA 70 CG32279-PA 1..70 6..75 394 100 Plus
Drs-PA 70 CG10810-PA 1..70 6..75 328 78.6 Plus
Drsl5-PA 69 CG10812-PA 1..69 7..75 326 79.7 Plus
Drsl6-PA 72 CG32268-PA 1..72 6..75 299 69.4 Plus
Drsl4-PA 71 CG32282-PA 1..71 6..75 263 64.8 Plus
Drsl3-PA 71 CG32283-PA 1..71 6..75 260 64.8 Plus
Drsl1-PA 69 CG32274-PA 1..69 7..75 249 60.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14560-PA 70 GM14560-PA 1..70 6..75 368 98.6 Plus
Dsec\GM14569-PA 72 GM14569-PA 1..70 6..75 305 77.1 Plus
Dsec\GM14562-PA 69 GM14562-PA 1..69 7..75 301 78.3 Plus
Dsec\GM14055-PA 69 GM14055-PA 1..69 7..75 240 60.9 Plus
Dsec\GM14561-PA 71 GM14561-PA 1..71 6..75 237 64.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Drs-PA 70 GD13760-PA 1..70 6..75 310 78.6 Plus
Dsim\dro5-PA 69 GD13754-PA 1..69 7..75 308 79.7 Plus
Dsim\dro3-PA 71 GD13752-PA 1..71 6..75 251 66.2 Plus
Dsim\dro4-PA 71 GD13753-PA 1..71 6..75 246 64.8 Plus
Dsim\dro2-PA 89 GD13751-PA 32..83 2..53 241 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21352-PA 70 GE21352-PA 1..70 6..75 351 94.3 Plus
Dyak\GE21361-PA 70 GE21361-PA 1..70 6..75 310 78.6 Plus
Dyak\GE21355-PA 69 GE21355-PA 1..69 7..75 298 76.8 Plus
Dyak\GE20688-PA 72 GE20688-PA 1..72 6..75 282 68.1 Plus
Dyak\GE21353-PA 71 GE21353-PA 1..71 6..75 248 64.8 Plus