Clone LP14110 Report

Search the DGRC for LP14110

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:141
Well:10
Vector:pOT2
Associated Gene/TranscriptOsi2-RA
Protein status:LP14110.pep: gold
Sequenced Size:1382

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1148 2003-01-01 Sim4 clustering to Release 3
CG1148 2004-06-20 Blastp of sequenced clone
Osi2 2008-04-29 Release 5.5 accounting
Osi2 2008-08-15 Release 5.9 accounting
Osi2 2008-12-18 5.12 accounting

Clone Sequence Records

LP14110.complete Sequence

1382 bp (1382 high quality bases) assembled on 2004-06-20

GenBank Submission: BT015251

> LP14110.complete
ACAGAGTCGCTCGGAAAACGCGTCAAGGATATACCTAACCAAAATCACCC
CAGGCGCTTATAGGAAACAGCAAAAGCCATGGCAATGAGAGCGCTCATCT
TTCTGGCCCTCGCCACTCTGGTGGCTGGCGAAGGTCTTCGGCTTCCGGAC
CAGCAGTCGTCCAACAACATCCAGCAAGTCTACGCACCGCAGCCACCGGC
TCAGCAGATCCAGCAACCCCAGCAGCAACAACAGTTTCCACAGGCACAGC
AGCCAGGAGTTGGCGAGGAACGCGGACGCTCCTCCCTGCTCAGCATCTTT
GGCCTGGGCAACGACAACGATCCCTTCCTGGCCAGGACCAACAGCAACTG
CCTCGGCGGCGACCTCTCCGAGTGCTTCAAGACTCAGGCGCTCAACACCT
TCGACGAGATCTTCTTCAAGGACCAGTACAAGCTCTCCGACTTTGCTCGT
GTGGTGCGACTGCCAGAAACCCAGCAGAGGTCCTTGCTGCAGGAGCCATT
CGAGTACTCCGAGGAGCCACGTGGCGACGACGACGAGTGGAATCAGCTGC
TGAAATATGGACTCCGAAGGGCCGAACGCTTCATCAAGTCCACGGCTCTA
GAGGTCGAGTGGCCCGAGGAACTCACCGAAGCCGGTCGTTATGAAGCACG
CTTCATCGGAAACGACATTGATGGCGAACTGGACCTCATTGATGATGGAC
AGCGGGCTGGACATTTCTCGCGTAAGAAGTTGAAGAAGATGATCATTCCC
CTGCTGCTGGTGCTGAAGATCTTCAAGCTGAAGTTGCTGCTCTTCCTGCC
CTTCATCCTTGGAATCGCTGGCCTCAAGAAGATCCTTGGATTGGCCGCTA
TTGTCCTGCCCGGTCTGTTCGCCTACTTCAAGCTGTGCCGTCCGCCAGGT
GGTGTTGGAGGAGCATTCGGCGGTGGACTGTCGGGCCTGTTTGGCGGCAA
GAACACCTTCCCCGAGTACAACCCCCAGGGAGTGGGAGCTGCCACCTACT
ACCACCACCACGAGCACTTTGAGGGCGGCCATGGAGGCGCTCCAGGACCT
TACTACCGCCAGGAGCCAAGCTTTGCCAAGCCCTACACCGACTACTACAG
CAAGAGCTACCAGGGCCAGCAGGTCCAGGGCCAGCAGGTTGGCGGCAACT
CCGTCAGCTTCGGGGATCCGCAGGAGGCGGCCTACAACGGATACTATGGA
CGAAACTCCGGCAAGGACATTGTCGCCGAGCAACAGCCTCAGAAGAGCTA
ACTTCGAGGACTCCAACCACCTCCGCGTTGTTATTTATTCGGCCTTCGGC
CTTGTTGCATTCCTATAAGAATATTTATTACGCTAATTGTAAATAAAATA
AAGTTTGTAAAATAAAAAAAAAAAAAAAAAAA

LP14110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Osi2.b 1886 Osi2.b 65..1430 1..1366 6830 100 Plus
Osi2.c 1746 Osi2.c 369..1734 1..1366 6830 100 Plus
Osi2.a 1451 Osi2.a 65..1430 1..1366 6830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2038501..2039145 719..1363 3225 100 Plus
chr3R 27901430 chr3R 2037110..2037467 75..432 1790 100 Plus
chr3R 27901430 chr3R 2037745..2037891 432..578 735 100 Plus
chr3R 27901430 chr3R 2038040..2038180 578..718 705 100 Plus
chr3R 27901430 chr3R 2035053..2035128 1..76 380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6212849..6213496 719..1366 3240 100 Plus
3R 32079331 3R 6211458..6211815 75..432 1790 100 Plus
3R 32079331 3R 6212093..6212239 432..578 735 100 Plus
3R 32079331 3R 6212388..6212528 578..718 705 100 Plus
3R 32079331 3R 6209401..6209476 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5953680..5954327 719..1366 3240 100 Plus
3R 31820162 3R 5952289..5952646 75..432 1790 100 Plus
3R 31820162 3R 5952924..5953070 432..578 735 100 Plus
3R 31820162 3R 5953219..5953359 578..718 705 100 Plus
3R 31820162 3R 5950232..5950307 1..76 380 100 Plus
Blast to na_te.dros performed 2019-03-15 20:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2517 147..351 168 57.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2765..3025 161..410 161 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6886 162..255 160 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6865 162..252 144 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6732..6833 149..253 139 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..6815 162..253 135 64.1 Plus
roo 9092 roo DM_ROO 9092bp 1081..1150 186..255 134 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2393 172..255 132 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1507..1589 161..255 131 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6532..6585 213..266 125 74.5 Plus
roo 9092 roo DM_ROO 9092bp 1059..1160 149..253 120 62.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6934 139..273 119 57.7 Plus
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 2234..2272 219..259 119 80.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2469 202..363 118 54.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..6893 202..363 116 56.5 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3259..3330 183..253 114 63.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2917..2971 806..752 113 67.3 Minus

LP14110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:44 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2035053..2035128 1..76 100 -> Plus
chr3R 2037112..2037466 77..431 100 -> Plus
chr3R 2037745..2037891 432..578 100 -> Plus
chr3R 2038041..2038180 579..718 100 -> Plus
chr3R 2038501..2039145 719..1363 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:35 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 1..1173 79..1251 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:35:50 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 1..1173 79..1251 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:05:47 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RB 1..1173 79..1251 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:19:40 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 1..1173 79..1251 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:14 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RB 1..1173 79..1251 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:42:43 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 187..1473 76..1362 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:35:49 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 187..1473 76..1362 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:47 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RC 29..1391 1..1363 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:19:40 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RA 187..1473 76..1362 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:14 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
Osi2-RC 29..1391 1..1363 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:44 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6209401..6209476 1..76 100 -> Plus
3R 6211460..6211814 77..431 100 -> Plus
3R 6212093..6212239 432..578 100 -> Plus
3R 6212389..6212528 579..718 100 -> Plus
3R 6212849..6213493 719..1363 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:44 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6209401..6209476 1..76 100 -> Plus
3R 6211460..6211814 77..431 100 -> Plus
3R 6212093..6212239 432..578 100 -> Plus
3R 6212389..6212528 579..718 100 -> Plus
3R 6212849..6213493 719..1363 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:44 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6209401..6209476 1..76 100 -> Plus
3R 6211460..6211814 77..431 100 -> Plus
3R 6212093..6212239 432..578 100 -> Plus
3R 6212389..6212528 579..718 100 -> Plus
3R 6212849..6213493 719..1363 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:47 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2035123..2035198 1..76 100 -> Plus
arm_3R 2037182..2037536 77..431 100 -> Plus
arm_3R 2037815..2037961 432..578 100 -> Plus
arm_3R 2038111..2038250 579..718 100 -> Plus
arm_3R 2038571..2039215 719..1363 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:56:56 Download gff for LP14110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5952291..5952645 77..431 100 -> Plus
3R 5952924..5953070 432..578 100 -> Plus
3R 5953220..5953359 579..718 100 -> Plus
3R 5953680..5954324 719..1363 100   Plus
3R 5950232..5950307 1..76 100 -> Plus

LP14110.hyp Sequence

Translation from 78 to 1250

> LP14110.hyp
MAMRALIFLALATLVAGEGLRLPDQQSSNNIQQVYAPQPPAQQIQQPQQQ
QQFPQAQQPGVGEERGRSSLLSIFGLGNDNDPFLARTNSNCLGGDLSECF
KTQALNTFDEIFFKDQYKLSDFARVVRLPETQQRSLLQEPFEYSEEPRGD
DDEWNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGE
LDLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLK
KILGLAAIVLPGLFAYFKLCRPPGGVGGAFGGGLSGLFGGKNTFPEYNPQ
GVGAATYYHHHEHFEGGHGGAPGPYYRQEPSFAKPYTDYYSKSYQGQQVQ
GQQVGGNSVSFGDPQEAAYNGYYGRNSGKDIVAEQQPQKS*

LP14110.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Osi2-PC 390 CG1148-PC 1..390 1..390 2057 100 Plus
Osi2-PA 390 CG1148-PA 1..390 1..390 2057 100 Plus
Osi2-PB 390 CG1148-PB 1..390 1..390 2057 100 Plus

LP14110.pep Sequence

Translation from 78 to 1250

> LP14110.pep
MAMRALIFLALATLVAGEGLRLPDQQSSNNIQQVYAPQPPAQQIQQPQQQ
QQFPQAQQPGVGEERGRSSLLSIFGLGNDNDPFLARTNSNCLGGDLSECF
KTQALNTFDEIFFKDQYKLSDFARVVRLPETQQRSLLQEPFEYSEEPRGD
DDEWNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGE
LDLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLK
KILGLAAIVLPGLFAYFKLCRPPGGVGGAFGGGLSGLFGGKNTFPEYNPQ
GVGAATYYHHHEHFEGGHGGAPGPYYRQEPSFAKPYTDYYSKSYQGQQVQ
GQQVGGNSVSFGDPQEAAYNGYYGRNSGKDIVAEQQPQKS*

LP14110.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16375-PA 384 GF16375-PA 1..384 1..389 1386 86.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13136-PA 389 GG13136-PA 1..389 1..390 1985 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14018-PA 406 GH14018-PA 1..404 3..389 1150 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Osi2-PC 390 CG1148-PC 1..390 1..390 2057 100 Plus
Osi2-PA 390 CG1148-PA 1..390 1..390 2057 100 Plus
Osi2-PB 390 CG1148-PB 1..390 1..390 2057 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24391-PA 398 GI24391-PA 1..398 3..390 1295 79.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24055-PA 404 GL24055-PA 1..395 1..384 1362 83.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11025-PA 404 GA11025-PA 1..395 1..384 1366 83.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10863-PA 390 GM10863-PA 1..390 1..390 2026 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19845-PA 390 GD19845-PA 1..390 1..390 2031 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14247-PA 397 GJ14247-PA 1..394 3..389 1357 82.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13033-PA 397 GK13033-PA 1..385 1..384 1324 81.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10186-PA 390 GE10186-PA 1..390 1..390 2002 97.7 Plus