Clone LP14436 Report

Search the DGRC for LP14436

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:144
Well:36
Vector:pOT2
Associated Gene/TranscriptCG12796-RA
Protein status:LP14436.pep: gold
Sequenced Size:1237

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12796 2003-01-01 Sim4 clustering to Release 3
CG12796 2004-01-13 Blastp of sequenced clone
CG12796 2008-04-29 Release 5.5 accounting
CG12796 2008-08-15 Release 5.9 accounting
CG12796 2008-12-18 5.12 accounting

Clone Sequence Records

LP14436.complete Sequence

1237 bp (1237 high quality bases) assembled on 2004-01-13

GenBank Submission: BT011376

> LP14436.complete
CGCTTCGTTTACCATCGTGGCTCATGGCATTTACCAGCAGCTCATCGCCC
GCTTGGGATTATCGAAGCTCCCCGGAAGCGTTGGGTGTCGTCCCGTTCCT
GTGGCAGCACCAGAACGCCACGGAAACGCCAACGGAAATAACCCTCCAGG
CGACCAGTTTCGGTGCCGGCCATCTGCTGTGGCTAGCCATCAATGCCTTC
TTGTTTGTCCTTATCCTGGGCGGCAATATTCTGACCATTGTGGCGGTGCG
CACCTGCCGCCACCTGCGATCGGTCATCTCCAATCTGTTCATCCTGTCGC
TGGCCGTCTCCGACTTCTGTGTGGGACTGGCACTGCCCTATCATCTGGTA
TTTTACATGGGCTCGGACATTGGCGCCATGAGAGGTCCCTGCCTGCTGCG
CTTCTTCCTGCTCATCTGCGCCTGCTGCGTGTCCATGTTGACTCTGATCT
CGATTGCGGTGGATCGGTATATAGCAGTCGTCTATGCTCTGCACTATAGA
AGATACATGACCCGTCGAGTGGCATATAGCATCATCATATTCAATTGGTG
CTTGGGTGCATTGGTGGCTCTGCTGCCAGTGTTCTGGAATCGATGGCCGG
ATGCACAGGCGTGCGAATTCGACGAAGTTCTCGCGCCTGGTTACATTGCC
GGAGTGATAACGCCGGGTTTTGTGATCATCTGGATCTGTATGTTCCTCGT
CTACTGGCGCATCATGCGCGAGGCATCCAAGCAGGCGCTGCGATTGCGAC
AGTCGGTGGTCTACAACACGGACGAGGCCACCACCATGCGAAATCTGCTG
CTCCATCCAGACTGGAAGAGCGTCCAGATTGTGGTCTTCATCATGGGCTG
CTTCACGCTCTGTTGGCTACCGTACTTCTGTGTGGCCATTGCCCAGCTAT
TTAGCATCTGCCAGAGCAGCTCGATGATCTACAAGACGACGTTCTCTCTG
GCCATTGCCAACTCTGCTCTCAATCCGATTATCTACTCGTGGAAGAACTC
TGGCTTTCGGCGAGCCTTTGTCCAAACATTATGCTGCCGAACGGCGAGGC
AGTGCGAGGATCAATTGCCGGCGGACAGCAAGCACCGCATGGAGGCCACA
TCCTCATCTCAGGAGATCAAACCGAAGGCCACTCAGTGATCAACGGAATT
GGGAAACCCAACGCTTTAACTTGGTAGAATTAAATGGAGATATAGCAATA
AAAGTGGACATTATCTTTAAAAAAAAAAAAAAAAAAA

LP14436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12796-RA 1218 CG12796-RA 1..1218 1..1218 6090 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6723559..6724276 1218..501 3500 99.2 Minus
chrX 22417052 chrX 6724345..6724846 502..1 2390 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:56:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6831396..6832114 1219..501 3595 100 Minus
X 23542271 X 6832183..6832684 502..1 2510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6839494..6840212 1219..501 3595 100 Minus
X 23527363 X 6840281..6840782 502..1 2510 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:01:06 has no hits.

LP14436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:03 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6723559..6724274 503..1218 99 <- Minus
chrX 6724345..6724846 1..502 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:40 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:39 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:00 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:29 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:37 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:25 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:38 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1218 1..1218 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:00 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1218 1..1218 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:29 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1116 24..1139 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:37 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
CG12796-RA 1..1218 1..1218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:03 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
X 6831397..6832112 503..1218 100 <- Minus
X 6832183..6832684 1..502 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:03 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
X 6831397..6832112 503..1218 100 <- Minus
X 6832183..6832684 1..502 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:03 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
X 6831397..6832112 503..1218 100 <- Minus
X 6832183..6832684 1..502 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:00 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6725430..6726145 503..1218 100 <- Minus
arm_X 6726216..6726717 1..502 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:04:02 Download gff for LP14436.complete
Subject Subject Range Query Range Percent Splice Strand
X 6839495..6840210 503..1218 100 <- Minus
X 6840281..6840782 1..502 100   Minus

LP14436.hyp Sequence

Translation from 2 to 1138

> LP14436.hyp
LRLPSWLMAFTSSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQA
TSFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSL
AVSDFCVGLALPYHLVFYMGSDIGAMRGPCLLRFFLLICACCVSMLTLIS
IAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPD
AQACEFDEVLAPGYIAGVITPGFVIIWICMFLVYWRIMREASKQALRLRQ
SVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLF
SICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTLCCRTARQ
CEDQLPADSKHRMEATSSSQEIKPKATQ*

LP14436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12796-PA 371 CG12796-PA 1..371 8..378 1957 100 Plus
Octbeta1R-PB 421 CG6919-PB 100..419 54..343 272 29.2 Plus
Octbeta1R-PC 428 CG6919-PC 100..419 54..343 272 29.2 Plus
Octbeta1R-PE 508 CG6919-PE 100..419 54..343 272 29.2 Plus
Octbeta1R-PA 508 CG6919-PA 100..419 54..343 272 29.2 Plus

LP14436.pep Sequence

Translation from 23 to 1138

> LP14436.pep
MAFTSSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAGH
LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCV
GLALPYHLVFYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYI
AVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPDAQACEFD
EVLAPGYIAGVITPGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTD
EATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSS
MIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTLCCRTARQCEDQLPA
DSKHRMEATSSSQEIKPKATQ*

LP14436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21114-PA 374 GF21114-PA 1..371 1..368 1611 82.6 Plus
Dana\GF23002-PA 628 GF23002-PA 162..519 55..366 266 29.1 Plus
Dana\GF18779-PA 492 GF18779-PA 105..446 31..340 254 29.9 Plus
Dana\GF16200-PA 770 GF16200-PA 29..382 28..362 244 26.7 Plus
Dana\GF18857-PA 547 GF18857-PA 107..479 47..355 224 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17652-PA 378 GG17652-PA 1..378 1..371 1850 92.9 Plus
Dere\GG17113-PA 610 GG17113-PA 132..510 26..366 277 28 Plus
Dere\GG21429-PA 496 GG21429-PA 108..458 31..348 261 30.5 Plus
Dere\GG11143-PA 508 GG11143-PA 100..419 47..336 249 29 Plus
Dere\GG11961-PA 778 GG11961-PA 58..381 67..362 236 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17569-PA 414 GH17569-PA 44..403 31..368 1251 67.9 Plus
Dgri\GH18896-PA 626 GH18896-PA 182..531 59..366 271 28 Plus
Dgri\GH14430-PA 512 GH14430-PA 108..431 47..338 266 31.3 Plus
Dgri\GH18390-PA 789 GH18390-PA 61..374 67..360 248 28.6 Plus
Dgri\GH19686-PA 406 GH19686-PA 118..368 128..348 212 28.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
mAChR-C-PA 371 CG12796-PA 1..371 1..371 1957 100 Plus
Octbeta3R-PJ 445 CG42244-PJ 89..429 5..338 301 30.1 Plus
Octbeta2R-PG 536 CG33976-PG 150..511 50..366 289 28 Plus
Octbeta2R-PE 536 CG33976-PE 150..511 50..366 289 28 Plus
Octbeta2R-PD 536 CG33976-PD 150..511 50..366 289 28 Plus
Octbeta2R-PC 536 CG33976-PC 150..511 50..366 289 28 Plus
Octbeta2R-PA 536 CG33976-PA 150..511 50..366 289 28 Plus
Octbeta2R-PF 630 CG33976-PF 150..511 50..366 289 28 Plus
Octbeta1R-PB 421 CG6919-PB 100..419 47..336 272 29.2 Plus
Octbeta1R-PC 428 CG6919-PC 100..419 47..336 272 29.2 Plus
Octbeta1R-PE 508 CG6919-PE 100..419 47..336 272 29.2 Plus
Octbeta1R-PA 508 CG6919-PA 100..419 47..336 272 29.2 Plus
Dop1R1-PB 496 CG9652-PB 129..454 54..344 271 30.9 Plus
Dop1R1-PD 511 CG9652-PD 144..469 54..344 271 30.9 Plus
Dop1R1-PF 535 CG9652-PF 129..454 54..344 271 30.9 Plus
Dop1R1-PE 560 CG9652-PE 129..454 54..344 271 30.9 Plus
Dop1R1-PC 481 CG9652-PC 116..439 56..344 270 31.1 Plus
AdoR-PB 772 CG9753-PB 58..381 67..362 268 28.6 Plus
AdoR-PA 774 CG9753-PA 58..381 67..362 268 28.6 Plus
TkR86C-PA 504 CG6515-PA 85..380 52..338 233 25.2 Plus
TkR86C-PB 555 CG6515-PB 85..380 52..338 233 25.2 Plus
TkR99D-PB 517 CG7887-PB 102..392 51..332 223 24.3 Plus
TkR99D-PA 519 CG7887-PA 102..392 51..332 223 24.3 Plus
TkR99D-PC 564 CG7887-PC 102..392 51..332 223 24.3 Plus
AstC-R2-PE 549 CG13702-PE 146..448 51..352 215 21.5 Plus
AstC-R2-PB 549 CG13702-PB 146..448 51..352 215 21.5 Plus
AstC-R2-PD 567 CG13702-PD 146..448 51..352 215 21.5 Plus
AstC-R2-PF 593 CG13702-P2-RF 146..448 51..352 215 21.5 Plus
Oct-TyrR-PB 601 CG7485-PB 110..321 51..262 186 31.2 Plus
Oct-TyrR-PA 601 CG7485-PA 110..321 51..262 186 31.2 Plus
TyrR-PC 631 CG7431-PC 117..298 51..230 186 32.6 Plus
TyrR-PB 631 CG7431-PB 117..298 51..230 186 32.6 Plus
TyrR-PA 631 CG7431-PA 117..298 51..230 186 32.6 Plus
Octbeta3R-PK 456 CG42244-PK 89..342 5..244 185 28.6 Plus
Octbeta3R-PG 1118 CG42244-PG 89..342 5..244 185 28.6 Plus
Octbeta3R-PF 1256 CG42244-PF 89..342 5..244 185 28.6 Plus
Oamb-PB 637 CG3856-PB 20..173 50..210 184 34.1 Plus
Oamb-PF 645 CG3856-PF 20..173 50..210 184 34.1 Plus
Oamb-PC 645 CG3856-PC 20..173 50..210 184 34.1 Plus
Oamb-PE 682 CG3856-PE 20..173 50..210 184 34.1 Plus
Oamb-PG 714 CG3856-PG 20..173 50..210 184 34.1 Plus
Oamb-PD 751 CG3856-PD 20..173 50..210 184 34.1 Plus
mAChR-B-PB 755 CG7918-PB 141..341 58..246 178 27.9 Plus
mAChR-B-PA 1019 CG7918-PA 141..341 58..246 178 27.9 Plus
Dop2R-PF 760 CG33517-PF 375..578 50..253 170 28 Plus
Dop2R-PJ 805 CG33517-PJ 375..578 50..253 170 28 Plus
Dop2R-PG 897 CG33517-PG 375..578 50..253 170 28 Plus
Dop2R-PI 904 CG33517-PI 375..578 50..253 170 28 Plus
Dop2R-PH 905 CG33517-PH 375..578 50..253 170 28 Plus
Octalpha2R-PC 670 CG18208-PC 121..307 56..240 166 30.5 Plus
Octalpha2R-PA 699 CG18208-PA 121..307 56..240 166 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21645-PA 411 GI21645-PA 66..399 44..367 1241 73.1 Plus
Dmoj\GI10046-PA 520 GI10046-PA 113..443 43..341 271 31.3 Plus
Dmoj\GI23111-PA 627 GI23111-PA 177..537 51..366 260 27.5 Plus
Dmoj\GI24543-PA 496 GI24543-PA 119..450 34..340 257 30 Plus
Dmoj\GI23382-PA 821 GI23382-PA 25..389 23..362 250 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16427-PA 454 GL16427-PA 72..415 21..357 1409 78.5 Plus
Dper\GL13571-PA 632 GL13571-PA 164..524 51..366 260 28.2 Plus
Dper\GL13808-PA 513 GL13808-PA 108..434 47..341 259 31.4 Plus
Dper\GL23301-PA 498 GL23301-PA 115..460 31..348 254 29.5 Plus
Dper\GL14068-PA 743 GL14068-PA 58..380 67..362 236 28.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11816-PA 404 GA11816-PA 11..365 24..357 1410 76.3 Plus
Dpse\GA26829-PC 498 GA26829-PC 209..482 67..338 272 31.5 Plus
Dpse\GA26828-PB 549 GA26828-PB 164..524 51..366 260 28.2 Plus
Dpse\GA26828-PA 625 GA26828-PA 164..524 51..366 260 28.2 Plus
Dpse\GA21941-PC 371 GA21941-PC 1..333 52..348 255 30 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12547-PA 373 GM12547-PA 1..373 1..371 1873 94.9 Plus
Dsec\GM25999-PA 535 GM25999-PA 61..437 28..366 283 28.6 Plus
Dsec\GM25874-PA 496 GM25874-PA 108..458 31..348 260 30.5 Plus
Dsec\GM26442-PA 508 GM26442-PA 86..419 28..336 252 28.5 Plus
Dsec\GM12178-PA 774 GM12178-PA 58..381 67..362 237 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16175-PA 375 GD16175-PA 1..375 1..371 1904 96 Plus
Dsim\GD20557-PA 611 GD20557-PA 137..513 28..366 282 28.2 Plus
Dsim\GD20445-PA 422 GD20445-PA 34..384 31..348 261 30.5 Plus
Dsim\GD20216-PA 443 GD20216-PA 116..438 51..352 256 29.5 Plus
Dsim\GD20960-PA 508 GD20960-PA 86..419 28..336 251 28.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16883-PA 406 GJ16883-PA 64..382 47..360 1263 74.6 Plus
Dvir\GJ22571-PA 506 GJ22571-PA 101..421 50..338 261 31.3 Plus
Dvir\GJ10601-PA 614 GJ10601-PA 173..522 59..366 259 27.8 Plus
Dvir\GJ22610-PA 489 GJ22610-PA 130..443 58..340 251 30.2 Plus
Dvir\GJ10376-PA 796 GJ10376-PA 25..389 20..362 241 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16394-PA 357 GK16394-PA 10..357 27..371 1310 72.5 Plus
Dwil\GK13569-PA 609 GK13569-PA 173..522 59..366 261 27.8 Plus
Dwil\GK12816-PA 489 GK12816-PA 76..408 47..346 257 30.9 Plus
Dwil\GK10900-PA 492 GK10900-PA 105..446 31..340 255 29.9 Plus
Dwil\GK13150-PA 782 GK13150-PA 25..380 23..360 235 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16441-PA 375 GE16441-PA 1..375 1..371 1840 92.8 Plus
Dyak\GE24503-PA 612 GE24503-PA 133..511 26..366 277 28 Plus
Dyak\GE10051-PA 494 GE10051-PA 106..456 31..348 261 30.5 Plus
Dyak\GE10309-PA 514 GE10309-PA 92..425 28..336 254 28.5 Plus
Dyak\GE23411-PA 774 GE23411-PA 58..381 67..362 237 28.3 Plus