BDGP Sequence Production Resources |
Search the DGRC for LP14856
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 148 |
Well: | 56 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12481-RB |
Protein status: | LP14856.pep: gold |
Sequenced Size: | 607 |
Gene | Date | Evidence |
---|---|---|
CG12481 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12481 | 2004-01-13 | Blastp of sequenced clone |
CG12481 | 2008-04-29 | Release 5.5 accounting |
CG12481 | 2008-08-15 | Release 5.9 accounting |
CG12481 | 2008-12-18 | 5.12 accounting |
607 bp (607 high quality bases) assembled on 2004-01-13
GenBank Submission: BT011373
> LP14856.complete TTCGCAGCAGGAATCGGATTTCAGTCATGTGGACCAAATCAAGTGTTGTC ATCGTTGCAATGGCGCTGTTAGCTTCAACTGGCGCCCAACCGGTGAGCCA GACGGAAATGGAACCGATGCTCATCAATGTGACCACAAGCAGACCCAAGC TGGTCATTGAGGAGATGGAACCGATGCGTTATCACTTCGTCACCGAGCAT AGACCCACTTCGTTGGGCCAGAACTATTACATCAAACCGGGTCAGCCGGT GGGCAGTATTACCCTGGACTCGGATACCCTGCAGGTGCGATACGATCAGG ATGACGGGAAACCGGTGGCCAGCAAGCACAACATCCTGTTCGTGGCCTAC GCCAAGGATCTGGCCCAAAAGTCCAGACAGCGGAAGTGAAAAATATGCTT CAATTGTGCTGCGATGATATTTGAAATTTAAGAAAGATATAGAATCAACA TATCTTGACAAATTGAAACCACAAGATACGTAGTGATTTAAATCTTAAGA TACCTTAAGATACATATGTCTTGAGCTTCACTAGTTATACATTTTCACGG AACATAAATAAAATAATATAGCACATTTTCTTAAATACCAAAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12481-RB | 589 | CG12481-RB | 1..589 | 1..589 | 2945 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 14077787..14078375 | 1..589 | 2840 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 14187253..14187849 | 1..597 | 2970 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 14195351..14195947 | 1..597 | 2970 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbuz\BuT2 | 2775 | Dbuz\BuT2 BUT2 2775bp | 135..224 | 514..427 | 121 | 64.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 14077787..14078375 | 1..589 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..363 | 27..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..363 | 27..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..363 | 27..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..363 | 27..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..363 | 27..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..589 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..589 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..589 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..589 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12481-RB | 1..589 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 14187253..14187841 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 14187253..14187841 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 14187253..14187841 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 14081286..14081874 | 1..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 14195351..14195939 | 1..589 | 100 | Plus |
Translation from 2 to 388
> LP14856.hyp RSRNRISVMWTKSSVVIVAMALLASTGAQPVSQTEMEPMLINVTTSRPKL VIEEMEPMRYHFVTEHRPTSLGQNYYIKPGQPVGSITLDSDTLQVRYDQD DGKPVASKHNILFVAYAKDLAQKSRQRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12481-PB | 120 | CG12481-PB | 1..120 | 9..128 | 613 | 100 | Plus |
Translation from 26 to 388
> LP14856.pep MWTKSSVVIVAMALLASTGAQPVSQTEMEPMLINVTTSRPKLVIEEMEPM RYHFVTEHRPTSLGQNYYIKPGQPVGSITLDSDTLQVRYDQDDGKPVASK HNILFVAYAKDLAQKSRQRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19241-PA | 118 | GF19241-PA | 6..118 | 9..117 | 379 | 64.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17829-PA | 118 | GG17829-PA | 1..117 | 1..117 | 562 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17825-PA | 98 | GH17825-PA | 5..90 | 35..116 | 205 | 48.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12481-PB | 120 | CG12481-PB | 1..120 | 1..120 | 613 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21741-PA | 106 | GI21741-PA | 24..101 | 36..111 | 249 | 58.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14841-PA | 124 | GL14841-PA | 3..124 | 5..120 | 308 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11654-PA | 124 | GA11654-PA | 7..124 | 9..120 | 300 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17659-PA | 120 | GM17659-PA | 1..120 | 1..120 | 608 | 95 | Plus |
Dsec\GM19964-PA | 120 | GM19964-PA | 1..120 | 1..120 | 608 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17158-PA | 120 | GD17158-PA | 1..120 | 1..120 | 590 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19122-PA | 92 | GJ19122-PA | 3..81 | 35..111 | 205 | 48.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18862-PA | 123 | GK18862-PA | 44..113 | 41..109 | 219 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17122-PA | 121 | GE17122-PA | 1..121 | 1..120 | 540 | 84.3 | Plus |