LP15064.complete Sequence
438 bp assembled on 2009-08-10
GenBank Submission: BT099522.1
> LP15064.complete
CGGAACGCCCGAACTGTAGTGCAGACGCACAAGTGCTCTTCCAAAGACCC
TTAAGACAATCTTGCAGTGATCCAACATGGTTGACCTCACCGACGCCGGC
TCGCCGTTCCAGCAATCCATTCCCGACTTCGCCTTCTACGTGCCGGCAAT
TGTTGTTTTTACCCTGGCAGCTCTCTTTGGCTACAAGCTGTACAAATCCC
TGACGGAAAAGGAGCTCAAGAAGCAGGAGAAACTGAAGAGCAAGCAACAG
AAGAAGGCCAAGAAGTCAAACTGAAGGAGATGGAGGCGAGGATATCATTG
ACGTAGTGCACTTTCCGGCCCTGAGACCTTCCATCTTGTTAATCAATACA
ATCGCCCTGTAAATGACTAAATCATAAACCAGTAAACGTAATAAAATAAA
ACGTACCCCATAACTCTTTTAAAAAAAAAAAAAAAAAA
LP15064.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:29:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42336-RB | 525 | CG42336-RB | 106..525 | 1..420 | 2100 | 100 | Plus |
CG18336.a | 1003 | CG18336.a | 5..260 | 168..423 | 1280 | 100 | Plus |
CG42336-RD | 635 | CG42336-RD | 383..635 | 168..420 | 1265 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:44:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7181977..7182229 | 420..168 | 1265 | 100 | Minus |
chr2R | 21145070 | chr2R | 7184703..7184872 | 170..1 | 835 | 99.4 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:44:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11294533..11294788 | 423..168 | 1280 | 100 | Minus |
2R | 25286936 | 2R | 11297262..11297431 | 170..1 | 850 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11295732..11295987 | 423..168 | 1280 | 100 | Minus |
2R | 25260384 | 2R | 11298461..11298630 | 170..1 | 850 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 02:44:12 has no hits.
LP15064.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:45:08 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7181977..7182226 | 171..420 | 100 | <- | Minus |
chr2R | 7184703..7184872 | 1..170 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:21 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 1..198 | 77..274 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:16 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 1..198 | 77..274 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:33 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 1..198 | 77..274 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:03 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 1..198 | 77..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 13:15:46 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 106..525 | 1..420 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:16 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 106..525 | 1..420 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:33 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 90..509 | 1..420 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:03 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42336-RB | 90..509 | 1..420 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11294536..11294785 | 171..420 | 100 | <- | Minus |
2R | 11297262..11297431 | 1..170 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11294536..11294785 | 171..420 | 100 | <- | Minus |
2R | 11297262..11297431 | 1..170 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11294536..11294785 | 171..420 | 100 | <- | Minus |
2R | 11297262..11297431 | 1..170 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:33 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7182041..7182290 | 171..420 | 100 | <- | Minus |
arm_2R | 7184767..7184936 | 1..170 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:49 Download gff for
LP15064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11295735..11295984 | 171..420 | 100 | <- | Minus |
2R | 11298461..11298630 | 1..170 | 100 | | Minus |
LP15064.hyp Sequence
Translation from 2 to 202
> LP15064.hyp
ERPNCSADAQVLFQRPLRQSCSDPTWLTSPTPARRSSNPFPTSPSTCRQL
LFLPWQLSLATSCTNP*
Sequence LP15064.hyp has no blast hits.
LP15064.pep Sequence
Translation from 76 to 273
> LP15064.pep
MVDLTDAGSPFQQSIPDFAFYVPAIVVFTLAALFGYKLYKSLTEKELKKQ
EKLKSKQQKKAKKSN*
LP15064.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:08:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12412-PA | 35 | GF12412-PA | 1..31 | 1..31 | 153 | 93.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:08:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22671-PA | 56 | GG22671-PA | 1..51 | 1..55 | 168 | 61.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42336-PB | 65 | CG13211-PA | 1..65 | 1..65 | 324 | 100 | Plus |
CG42336-PF | 140 | CG42336-PF | 83..140 | 8..65 | 184 | 67.2 | Plus |
CG42336-PE | 140 | CG42336-PE | 83..140 | 8..65 | 184 | 67.2 | Plus |
CG42336-PD | 162 | CG42336-PD | 125..162 | 28..65 | 174 | 92.1 | Plus |
CG42336-PC | 138 | CG13211-PB | 92..138 | 22..65 | 170 | 78.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:08:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30481-PA | 65 | GA30481-PA | 1..43 | 1..43 | 212 | 93 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:08:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19593-PA | 106 | GM19593-PA | 1..32 | 1..32 | 167 | 96.9 | Plus |
Dsec\GM16945-PA | 106 | GM16945-PA | 1..32 | 1..32 | 167 | 96.9 | Plus |
Dsec\GM20449-PA | 35 | GM20449-PA | 1..31 | 1..31 | 162 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:08:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25917-PA | 56 | GD25917-PA | 1..31 | 1..31 | 168 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:08:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13026-PA | 53 | GE13026-PA | 1..51 | 1..55 | 168 | 63.6 | Plus |