Clone LP15064 Report

Search the DGRC for LP15064

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:150
Well:64
Vector:pOT2
Associated Gene/TranscriptCG42336-RB
Protein status:LP15064.pep: gold
Sequenced Size:438

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG42336-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP15064.complete Sequence

438 bp assembled on 2009-08-10

GenBank Submission: BT099522.1

> LP15064.complete
CGGAACGCCCGAACTGTAGTGCAGACGCACAAGTGCTCTTCCAAAGACCC
TTAAGACAATCTTGCAGTGATCCAACATGGTTGACCTCACCGACGCCGGC
TCGCCGTTCCAGCAATCCATTCCCGACTTCGCCTTCTACGTGCCGGCAAT
TGTTGTTTTTACCCTGGCAGCTCTCTTTGGCTACAAGCTGTACAAATCCC
TGACGGAAAAGGAGCTCAAGAAGCAGGAGAAACTGAAGAGCAAGCAACAG
AAGAAGGCCAAGAAGTCAAACTGAAGGAGATGGAGGCGAGGATATCATTG
ACGTAGTGCACTTTCCGGCCCTGAGACCTTCCATCTTGTTAATCAATACA
ATCGCCCTGTAAATGACTAAATCATAAACCAGTAAACGTAATAAAATAAA
ACGTACCCCATAACTCTTTTAAAAAAAAAAAAAAAAAA

LP15064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RB 525 CG42336-RB 106..525 1..420 2100 100 Plus
CG18336.a 1003 CG18336.a 5..260 168..423 1280 100 Plus
CG42336-RD 635 CG42336-RD 383..635 168..420 1265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7181977..7182229 420..168 1265 100 Minus
chr2R 21145070 chr2R 7184703..7184872 170..1 835 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294533..11294788 423..168 1280 100 Minus
2R 25286936 2R 11297262..11297431 170..1 850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11295732..11295987 423..168 1280 100 Minus
2R 25260384 2R 11298461..11298630 170..1 850 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:44:12 has no hits.

LP15064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:45:08 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7181977..7182226 171..420 100 <- Minus
chr2R 7184703..7184872 1..170 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:21 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 1..198 77..274 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:16 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 1..198 77..274 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:33 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 1..198 77..274 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:03 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 1..198 77..274 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 13:15:46 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 106..525 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:16 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 106..525 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:33 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 90..509 1..420 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:03 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 90..509 1..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294536..11294785 171..420 100 <- Minus
2R 11297262..11297431 1..170 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294536..11294785 171..420 100 <- Minus
2R 11297262..11297431 1..170 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:08 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294536..11294785 171..420 100 <- Minus
2R 11297262..11297431 1..170 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:33 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7182041..7182290 171..420 100 <- Minus
arm_2R 7184767..7184936 1..170 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:49 Download gff for LP15064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11295735..11295984 171..420 100 <- Minus
2R 11298461..11298630 1..170 100   Minus

LP15064.hyp Sequence

Translation from 2 to 202

> LP15064.hyp
ERPNCSADAQVLFQRPLRQSCSDPTWLTSPTPARRSSNPFPTSPSTCRQL
LFLPWQLSLATSCTNP*
Sequence LP15064.hyp has no blast hits.

LP15064.pep Sequence

Translation from 76 to 273

> LP15064.pep
MVDLTDAGSPFQQSIPDFAFYVPAIVVFTLAALFGYKLYKSLTEKELKKQ
EKLKSKQQKKAKKSN*

LP15064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12412-PA 35 GF12412-PA 1..31 1..31 153 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22671-PA 56 GG22671-PA 1..51 1..55 168 61.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-PB 65 CG13211-PA 1..65 1..65 324 100 Plus
CG42336-PF 140 CG42336-PF 83..140 8..65 184 67.2 Plus
CG42336-PE 140 CG42336-PE 83..140 8..65 184 67.2 Plus
CG42336-PD 162 CG42336-PD 125..162 28..65 174 92.1 Plus
CG42336-PC 138 CG13211-PB 92..138 22..65 170 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30481-PA 65 GA30481-PA 1..43 1..43 212 93 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19593-PA 106 GM19593-PA 1..32 1..32 167 96.9 Plus
Dsec\GM16945-PA 106 GM16945-PA 1..32 1..32 167 96.9 Plus
Dsec\GM20449-PA 35 GM20449-PA 1..31 1..31 162 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25917-PA 56 GD25917-PA 1..31 1..31 168 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13026-PA 53 GE13026-PA 1..51 1..55 168 63.6 Plus