Clone LP15255 Report

Search the DGRC for LP15255

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:152
Well:55
Vector:pOT2
Associated Gene/TranscriptGstE5-RA
Protein status:LP15255.pep: gold
Sequenced Size:736

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17527 2003-01-01 Sim4 clustering to Release 3
CG17527 2004-11-04 Blastp of sequenced clone
GstE5 2008-04-29 Release 5.5 accounting
GstE5 2008-08-15 Release 5.9 accounting
GstE5 2008-12-18 5.12 accounting

Clone Sequence Records

LP15255.complete Sequence

736 bp (736 high quality bases) assembled on 2004-11-04

GenBank Submission: BT021355

> LP15255.complete
CTCAAAGTGCAAACATGGTCAAGTTAACTCTATATGGTGTGAATCCCAGT
CCACCAGTTCGTGCCGTCAAACTCACTCTGGCTGCCCTCCAGCTGCCCTA
TGAGTTTGTAAACGTTAATATTTCGGGTCAGGAGCAGCTTTCTGAGGAAT
ATCTAAAAAAGAATCCAGAGCACACGGTGCCAACACTGGAGGATGATGGT
AACTACATTTGGGACTCGCATGCCATTATCGCGTATCTGGTGTCCAAATA
TGCAGATTCGGATGCCCTGTATCCCAGAGATCTGCTCCAGCGAGCTGTGG
TGGATCAACGACTGCACTTCGAGACAGGAGTGGTTTTCGCCAATGGCATT
AAGGCCATTACCAAGCCGTTATTCTTTAATGGCCTGAACAGGATTCCCAA
GGAACGCTACGATGCCATTGTCGAGATCTATGACTTTGTGGAGACCTTCC
TCGCTGGACATGATTACATTGCTGGGGATCAGTTGACCATTGCCGATTTT
AGCCTGATCTCGTCGATTACCTCGCTGGTGGCGTTCGTGGAGATCGATAG
GTTGAAATATCCCAGGATCATCGAATGGGTCAGGCGTTTGGAGAAGCTGC
CTTACTACGAGGAGGCCAATGCGAAGGGAGCCCGGGAGTTGGAGACCATT
CTAAAGTCCACTAATTTCACCTTTGCAACCTAGAGTTCTGAAATTATAAT
AAATAATTTGGAAACTTGTAAAAAAAAAAAAAAAAA

LP15255.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
GstE5-RA 719 GstE5-RA 1..719 1..719 3595 100 Plus
GstE6-RA 753 GstE6-RA 30..364 15..349 580 78.2 Plus
GstE8-RA 711 GstE8-RA 382..539 392..549 355 81.6 Plus
GstE6-RA 753 GstE6-RA 411..584 396..569 285 77.5 Plus
GstE8-RA 711 GstE8-RA 149..242 159..252 170 78.7 Plus
GstE8-RA 711 GstE8-RA 260..358 270..368 165 77.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14291663..14292379 1..717 3570 99.9 Plus
chr2R 21145070 chr2R 14293059..14293714 15..670 790 74.7 Plus
chr2R 21145070 chr2R 14294005..14294459 48..502 610 75.6 Plus
chr2R 21145070 chr2R 14295024..14295414 159..549 530 75.7 Plus
chr2R 21145070 chr2R 14284194..14284360 325..159 265 77.2 Minus
chr2R 21145070 chr2R 14290465..14290548 159..242 210 83.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18404620..18405341 1..722 3610 100 Plus
2R 25286936 2R 18406042..18406697 15..670 790 74.7 Plus
2R 25286936 2R 18406988..18407442 48..502 565 74.9 Plus
2R 25286936 2R 18408004..18408394 159..549 545 76 Plus
2R 25286936 2R 18397155..18397321 325..159 280 77.8 Minus
2R 25286936 2R 18403419..18403502 159..242 210 83.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18405819..18406540 1..722 3610 100 Plus
2R 25260384 2R 18407241..18407575 15..349 580 78.2 Plus
2R 25260384 2R 18409436..18409593 392..549 355 81.6 Plus
2R 25260384 2R 18408280..18408389 141..250 295 84.5 Plus
2R 25260384 2R 18407622..18407795 396..569 285 77.5 Plus
2R 25260384 2R 18398354..18398473 325..206 240 80 Minus
2R 25260384 2R 18408531..18408641 392..502 225 80.1 Plus
2R 25260384 2R 18404618..18404701 159..242 210 83.3 Plus
2R 25260384 2R 18409203..18409296 159..252 170 78.7 Plus
2R 25260384 2R 18409314..18409412 270..368 165 77.7 Plus
2R 25260384 2R 18408187..18408227 48..88 145 90.2 Plus
2R 25260384 2R 18404886..18404962 427..503 145 79.2 Plus
Blast to na_te.dros performed on 2019-03-16 11:40:14 has no hits.

LP15255.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:41:05 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14291663..14292381 1..719 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:52 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:40 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:12:55 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:38 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:23 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:32:15 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:40 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..719 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:12:55 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 16..734 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:38 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 1..669 15..683 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:23 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
GstE5-RA 16..734 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:05 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18404620..18405338 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:05 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18404620..18405338 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:41:05 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18404620..18405338 1..719 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:12:55 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14292125..14292843 1..719 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:49:15 Download gff for LP15255.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18405819..18406537 1..719 100   Plus

LP15255.hyp Sequence

Translation from 2 to 682

> LP15255.hyp
QSANMVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEY
LKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVV
DQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFL
AGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLP
YYEEANAKGARELETILKSTNFTFAT*

LP15255.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
GstE5-PA 222 CG17527-PA 1..222 5..226 1136 100 Plus
GstE6-PA 222 CG17530-PA 1..220 5..224 884 75.5 Plus
GstE8-PB 222 CG17533-PB 1..222 5..226 846 71.2 Plus
GstE8-PA 222 CG17533-PA 1..222 5..226 846 71.2 Plus
GstE7-PA 223 CG17531-PA 1..222 5..226 846 69.8 Plus

LP15255.pep Sequence

Translation from 14 to 682

> LP15255.pep
MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKN
PEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRL
HFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHD
YIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYYEE
ANAKGARELETILKSTNFTFAT*

LP15255.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12171-PA 222 GF12171-PA 1..220 1..220 856 70.5 Plus
Dana\GF12172-PA 222 GF12172-PA 1..220 1..220 820 66.8 Plus
Dana\GF12174-PA 221 GF12174-PA 1..221 1..222 780 64 Plus
Dana\GF12173-PA 221 GF12173-PA 1..221 1..222 773 64 Plus
Dana\GF12169-PA 221 GF12169-PA 1..218 1..219 702 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21887-PA 222 GG21887-PA 1..222 1..222 1071 91.4 Plus
Dere\GG21888-PA 240 GG21888-PA 19..238 1..220 907 74.5 Plus
Dere\GG21890-PA 222 GG21890-PA 1..222 1..222 858 69.4 Plus
Dere\GG21889-PA 222 GG21889-PA 1..221 1..222 844 69.4 Plus
Dere\GG21886-PA 222 GG21886-PA 1..219 1..219 730 58 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21669-PA 221 GH21669-PA 1..220 1..221 761 63.3 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..214 1..215 641 57.2 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..215 1..216 605 50.5 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..215 1..215 590 50.2 Plus
Dgri\GH13568-PA 220 GH13568-PA 1..213 1..215 482 45.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
GstE5-PA 222 CG17527-PA 1..222 1..222 1136 100 Plus
GstE6-PA 222 CG17530-PA 1..220 1..220 884 75.5 Plus
GstE8-PB 222 CG17533-PB 1..222 1..222 846 71.2 Plus
GstE8-PA 222 CG17533-PA 1..222 1..222 846 71.2 Plus
GstE7-PA 223 CG17531-PA 1..222 1..222 846 69.8 Plus
GstE4-PA 222 CG17525-PA 1..222 1..222 704 57.7 Plus
GstE3-PA 220 CG17524-PA 1..218 1..219 575 50.2 Plus
GstE9-PA 221 CG17534-PA 1..215 1..215 575 50.7 Plus
GstE10-PB 240 CG17522-PB 1..216 1..215 564 50.5 Plus
GstE10-PA 240 CG17522-PA 1..216 1..215 564 50.5 Plus
GstE1-PA 224 CG5164-PA 6..216 4..215 558 49.5 Plus
GstE2-PA 221 CG17523-PA 4..214 3..214 548 48.6 Plus
GstE11-PB 225 CG5224-PB 4..216 3..214 430 41.6 Plus
GstE11-PA 225 CG5224-PA 4..216 3..214 430 41.6 Plus
GstE12-PC 223 CG16936-PC 1..215 1..215 428 42.1 Plus
GstE12-PB 223 CG16936-PB 1..215 1..215 428 42.1 Plus
GstE12-PD 223 CG16936-PD 1..215 1..215 428 42.1 Plus
GstE12-PA 223 CG16936-PA 1..215 1..215 428 42.1 Plus
GstE13-PB 226 CG11784-PB 1..216 1..215 380 39.2 Plus
GstE13-PA 226 CG11784-PA 1..216 1..215 380 39.2 Plus
GstD4-PA 215 CG11512-PA 13..209 16..215 338 36 Plus
GstD3-PA 199 CG4381-PA 5..188 24..210 337 36.6 Plus
GstD8-PA 212 CG4421-PA 9..211 12..217 337 35.4 Plus
GstD6-PA 215 CG4423-PA 1..199 4..204 335 34.7 Plus
GstD11-PA 222 CG17639-PA 6..215 6..215 334 36.6 Plus
GstD11-PB 243 CG17639-PB 27..236 6..215 334 36.6 Plus
GstD5-PA 216 CG12242-PA 13..206 16..212 332 36.5 Plus
GstD7-PA 224 CG4371-PA 1..212 1..214 328 34.6 Plus
gfzf-PD 234 CG33546-PD 1..206 4..209 322 38.1 Plus
gfzf-PE 1045 CG33546-PE 812..1017 4..209 322 38.1 Plus
gfzf-PB 1045 CG33546-PB 812..1017 4..209 322 38.1 Plus
GstD1-PB 209 CG10045-PB 5..205 7..210 318 35.6 Plus
GstD1-PA 209 CG10045-PA 5..205 7..210 318 35.6 Plus
GstD9-PB 218 CG10091-PB 2..198 4..200 310 35.4 Plus
GstD9-PA 218 CG10091-PA 2..198 4..200 310 35.4 Plus
GstD2-PA 215 CG4181-PA 13..206 16..212 309 37.1 Plus
GstD10-PB 210 CG18548-PB 1..203 4..208 308 33 Plus
GstD10-PA 210 CG18548-PA 1..203 4..208 308 33 Plus
GstE14-PA 232 CG4688-PA 5..214 3..215 257 29.1 Plus
GstT1-PA 228 CG30000-PA 13..228 12..217 196 28.3 Plus
GstT2-PA 228 CG30005-PA 13..211 12..200 177 29.1 Plus
GstT3-PC 228 CG1702-PC 13..213 12..202 169 27.7 Plus
GstT3-PA 228 CG1702-PA 13..213 12..202 169 27.7 Plus
GstT3-PB 268 CG1702-PB 53..253 12..202 169 27.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20123-PA 221 GI20123-PA 1..220 1..221 730 62.4 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..221 1..221 680 56.1 Plus
Dmoj\GI20122-PA 221 GI20122-PA 1..218 1..219 669 61.2 Plus
Dmoj\GI20124-PA 221 GI20124-PA 1..209 1..209 625 54.1 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..213 1..214 573 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17773-PA 222 GL17773-PA 1..222 1..222 913 76.6 Plus
Dper\GL17771-PA 221 GL17771-PA 1..218 1..219 704 56.6 Plus
Dper\GL17770-PA 222 GL17770-PA 1..220 1..219 588 51.1 Plus
Dper\GL17772-PA 222 GL17772-PA 1..220 1..219 577 50.7 Plus
Dper\GL17774-PA 221 GL17774-PA 1..209 1..209 569 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14545-PA 222 GA14545-PA 1..222 1..222 914 76.6 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..218 1..219 707 56.6 Plus
Dpse\GA14541-PA 222 GA14541-PA 1..220 1..219 595 51.6 Plus
Dpse\GA24907-PA 222 GA24907-PA 1..220 1..219 578 50.7 Plus
Dpse\GA14548-PA 221 GA14548-PA 1..209 1..209 566 54.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21880-PA 222 GM21880-PA 1..222 1..222 1128 96.4 Plus
Dsec\GM21882-PA 222 GM21882-PA 1..222 1..222 864 69.8 Plus
Dsec\GM21881-PA 223 GM21881-PA 1..222 1..222 860 68.9 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..219 1..219 720 58 Plus
Dsec\GM19908-PA 240 GM19908-PA 1..216 1..215 580 50.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11374-PA 222 GD11374-PA 1..222 1..222 1138 97.3 Plus
Dsim\GD11375-PA 222 GD11375-PA 1..222 1..222 912 75.2 Plus
Dsim\GD11377-PA 222 GD11377-PA 1..222 1..222 867 70.3 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..222 1..222 859 69.4 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..219 1..219 717 58 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19893-PA 221 GJ19893-PA 1..218 1..219 727 67.6 Plus
Dvir\GJ19892-PA 219 GJ19892-PA 1..216 1..219 693 63 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..219 1..219 684 57.1 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..209 1..209 623 53.1 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..213 1..214 586 50.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22991-PA 222 GK22991-PA 1..221 1..221 786 66.5 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..219 1..219 747 60.7 Plus
Dwil\GK22989-PA 220 GK22989-PA 1..220 1..222 724 64.4 Plus
Dwil\GK22990-PA 220 GK22990-PA 1..220 1..222 723 65.3 Plus
Dwil\GK22984-PA 220 GK22984-PA 1..218 1..219 614 51.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11962-PA 222 GE11962-PA 1..221 1..221 1075 91.4 Plus
Dyak\GE11963-PA 222 GE11963-PA 1..220 1..220 896 74.1 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..221 1..222 863 69.8 Plus
Dyak\GE11965-PA 222 GE11965-PA 1..222 1..222 862 69.8 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..219 1..219 722 57.5 Plus