BDGP Sequence Production Resources |
Search the DGRC for LP15408
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 154 |
Well: | 8 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32988-RA |
Protein status: | LP15408.pep: gold |
Sequenced Size: | 848 |
Gene | Date | Evidence |
---|---|---|
CG32988 | 2003-01-01 | Sim4 clustering to Release 3 |
CG32988 | 2004-12-02 | Blastp of sequenced clone |
CG32988 | 2008-04-29 | Release 5.5 accounting |
CG32988 | 2008-08-15 | Release 5.9 accounting |
CG32988 | 2008-12-18 | 5.12 accounting |
848 bp (848 high quality bases) assembled on 2004-12-02
GenBank Submission: BT021356
> LP15408.complete CAAAATTACATTATATTGACCTAAAATAATTGATTAACACATGAATAATC GCAATCGGGGTTGGGGTCGTTATGGCCTTAGAACCGGAAGACCTGGTGGC GAGCCAGTTCCTGCGGAGGGACCGGAGGTCTTAGTCATCAACGAGCGGGA GTTGCGGGCCTTCATCTTCCGGGTGTACCTATCCTCCGTAGTGCTGTGCC TGCTGTCTTCCATTTCGTGGATCATACTGTCGGCACTCGCTGTGAGGGTC TACAAGGCAATTCCAGTGCCGCCGTTCGTTTGGCTGATATTAGCTTTCAT CATTCTCTCAGTGCTCGGCTGCATCGCACAGACTCCAGCATTGACCTTGT TATGCTGGGGATTGGTGCTGGGATCCTTGTTCTTTCTCACCCTGTTCGGA GCGTATTATATGCATCTAGTGCGCGTCTGGGTCCTTTTGATTGCCATTTT GGTTGCCGGATCCCTGCTGGCCCTGCTGCATTTGTATGGGGCCAAAAGTC CGGAGGTTCTGCTACCCAACATTATCTGTACTTGCTGCATTTTTCTGCTG CTCACCGTCACCATGATCGTCCTGCTAATACTCTTCCTGATCATCAATGA TATGCGGTATCTCCTGGCACTTGCCATAGTGTTCGTCATCCTGATCGCAT TCATGGCTCCATTTCAGGCTCGTTTCATTTGTGGAAGGCTGCAGCAGGTG CCTTATGGGGAGACTGCGGATTGCGCCAATGGCATTTACCTACACTTTAT TTTTCTACTCTCCTGCATGCTCGTTTTTGCCCTGTACTATAAGCTAGTTA ATAGTTGAATAAAAAATATGTTGAGGCTGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8863772..8864600 | 1..829 | 4145 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8864864..8865693 | 1..830 | 4150 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8864864..8865693 | 1..830 | 4150 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8863772..8864600 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..829 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..829 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..768 | 41..808 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32988-RA | 1..829 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8864864..8865692 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8864864..8865692 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8864864..8865692 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8864864..8865692 | 1..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8864864..8865692 | 1..829 | 100 | Plus |
Translation from 40 to 807
> LP15408.pep MNNRNRGWGRYGLRTGRPGGEPVPAEGPEVLVINERELRAFIFRVYLSSV VLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPA LTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYG AKSPEVLLPNIICTCCIFLLLTVTMIVLLILFLIINDMRYLLALAIVFVI LIAFMAPFQARFICGRLQQVPYGETADCANGIYLHFIFLLSCMLVFALYY KLVNS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19717-PA | 254 | GF19717-PA | 13..254 | 10..255 | 605 | 50.4 | Plus |
Dana\GF15549-PA | 298 | GF15549-PA | 42..274 | 14..244 | 233 | 30.8 | Plus |
Dana\GF15548-PA | 251 | GF15548-PA | 19..232 | 36..246 | 191 | 29.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25308-PA | 252 | GG25308-PA | 1..252 | 1..255 | 976 | 76.9 | Plus |
Dere\GG25309-PA | 250 | GG25309-PA | 15..227 | 34..247 | 220 | 34.2 | Plus |
Dere\GG25307-PA | 257 | GG25307-PA | 20..233 | 38..248 | 153 | 24.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13867-PA | 240 | GH13867-PA | 7..236 | 26..255 | 330 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32988-PA | 255 | CG32988-PA | 1..255 | 1..255 | 1306 | 100 | Plus |
CG32983-PA | 250 | CG32983-PA | 22..227 | 41..247 | 281 | 31.4 | Plus |
CG32987-PA | 257 | CG32987-PA | 23..233 | 41..248 | 204 | 22.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17419-PA | 320 | GI17419-PA | 72..306 | 16..250 | 286 | 33.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25572-PA | 250 | GL25572-PA | 3..246 | 2..250 | 420 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17229-PA | 250 | GA17229-PA | 3..246 | 2..250 | 420 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17195-PA | 251 | GM17195-PA | 1..251 | 1..251 | 1175 | 91.6 | Plus |
Dsec\GM17206-PA | 250 | GM17206-PA | 16..227 | 34..247 | 214 | 30.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23569-PA | 250 | GD23569-PA | 1..248 | 1..249 | 1027 | 84.5 | Plus |
Dsim\GD23570-PA | 250 | GD23570-PA | 16..227 | 34..247 | 217 | 30.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18354-PA | 262 | GJ18354-PA | 17..251 | 14..250 | 261 | 30 | Plus |
Translation from 40 to 807
> LP15408.hyp MNNRNRGWGRYGLRTGRPGGEPVPAEGPEVLVINERELRAFIFRVYLSSV VLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPA LTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYG AKSPEVLLPNIICTCCIFLLLTVTMIVLLILFLIINDMRYLLALAIVFVI LIAFMAPFQARFICGRLQQVPYGETADCANGIYLHFIFLLSCMLVFALYY KLVNS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32988-PA | 255 | CG32988-PA | 1..255 | 1..255 | 1306 | 100 | Plus |
CG32983-PA | 250 | CG32983-PA | 22..227 | 41..247 | 281 | 31.4 | Plus |
CG32987-PA | 257 | CG32987-PA | 23..233 | 41..248 | 204 | 22.3 | Plus |