Clone LP15408 Report

Search the DGRC for LP15408

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:154
Well:8
Vector:pOT2
Associated Gene/TranscriptCG32988-RA
Protein status:LP15408.pep: gold
Sequenced Size:848

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32988 2003-01-01 Sim4 clustering to Release 3
CG32988 2004-12-02 Blastp of sequenced clone
CG32988 2008-04-29 Release 5.5 accounting
CG32988 2008-08-15 Release 5.9 accounting
CG32988 2008-12-18 5.12 accounting

Clone Sequence Records

LP15408.complete Sequence

848 bp (848 high quality bases) assembled on 2004-12-02

GenBank Submission: BT021356

> LP15408.complete
CAAAATTACATTATATTGACCTAAAATAATTGATTAACACATGAATAATC
GCAATCGGGGTTGGGGTCGTTATGGCCTTAGAACCGGAAGACCTGGTGGC
GAGCCAGTTCCTGCGGAGGGACCGGAGGTCTTAGTCATCAACGAGCGGGA
GTTGCGGGCCTTCATCTTCCGGGTGTACCTATCCTCCGTAGTGCTGTGCC
TGCTGTCTTCCATTTCGTGGATCATACTGTCGGCACTCGCTGTGAGGGTC
TACAAGGCAATTCCAGTGCCGCCGTTCGTTTGGCTGATATTAGCTTTCAT
CATTCTCTCAGTGCTCGGCTGCATCGCACAGACTCCAGCATTGACCTTGT
TATGCTGGGGATTGGTGCTGGGATCCTTGTTCTTTCTCACCCTGTTCGGA
GCGTATTATATGCATCTAGTGCGCGTCTGGGTCCTTTTGATTGCCATTTT
GGTTGCCGGATCCCTGCTGGCCCTGCTGCATTTGTATGGGGCCAAAAGTC
CGGAGGTTCTGCTACCCAACATTATCTGTACTTGCTGCATTTTTCTGCTG
CTCACCGTCACCATGATCGTCCTGCTAATACTCTTCCTGATCATCAATGA
TATGCGGTATCTCCTGGCACTTGCCATAGTGTTCGTCATCCTGATCGCAT
TCATGGCTCCATTTCAGGCTCGTTTCATTTGTGGAAGGCTGCAGCAGGTG
CCTTATGGGGAGACTGCGGATTGCGCCAATGGCATTTACCTACACTTTAT
TTTTCTACTCTCCTGCATGCTCGTTTTTGCCCTGTACTATAAGCTAGTTA
ATAGTTGAATAAAAAATATGTTGAGGCTGAAAAAAAAAAAAAAAAAAA

LP15408.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG32988-RA 829 CG32988-RA 1..829 1..829 4145 100 Plus
CG32988.a 781 CG32988.a 1..607 1..607 3035 100 Plus
CG32988.a 781 CG32988.a 606..769 667..830 820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8863772..8864600 1..829 4145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8864864..8865693 1..830 4150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8864864..8865693 1..830 4150 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:14:47 has no hits.

LP15408.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:15:48 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8863772..8864600 1..829 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:53 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:08 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:15 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:22 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:50 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:04 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:08 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..829 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:15 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..829 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:23 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..768 41..808 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:50 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
CG32988-RA 1..829 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:48 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8864864..8865692 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:48 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8864864..8865692 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:48 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8864864..8865692 1..829 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:15 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8864864..8865692 1..829 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:35 Download gff for LP15408.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8864864..8865692 1..829 100   Plus

LP15408.pep Sequence

Translation from 40 to 807

> LP15408.pep
MNNRNRGWGRYGLRTGRPGGEPVPAEGPEVLVINERELRAFIFRVYLSSV
VLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPA
LTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYG
AKSPEVLLPNIICTCCIFLLLTVTMIVLLILFLIINDMRYLLALAIVFVI
LIAFMAPFQARFICGRLQQVPYGETADCANGIYLHFIFLLSCMLVFALYY
KLVNS*

LP15408.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19717-PA 254 GF19717-PA 13..254 10..255 605 50.4 Plus
Dana\GF15549-PA 298 GF15549-PA 42..274 14..244 233 30.8 Plus
Dana\GF15548-PA 251 GF15548-PA 19..232 36..246 191 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25308-PA 252 GG25308-PA 1..252 1..255 976 76.9 Plus
Dere\GG25309-PA 250 GG25309-PA 15..227 34..247 220 34.2 Plus
Dere\GG25307-PA 257 GG25307-PA 20..233 38..248 153 24.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13867-PA 240 GH13867-PA 7..236 26..255 330 35.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG32988-PA 255 CG32988-PA 1..255 1..255 1306 100 Plus
CG32983-PA 250 CG32983-PA 22..227 41..247 281 31.4 Plus
CG32987-PA 257 CG32987-PA 23..233 41..248 204 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17419-PA 320 GI17419-PA 72..306 16..250 286 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25572-PA 250 GL25572-PA 3..246 2..250 420 40.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17229-PA 250 GA17229-PA 3..246 2..250 420 40.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17195-PA 251 GM17195-PA 1..251 1..251 1175 91.6 Plus
Dsec\GM17206-PA 250 GM17206-PA 16..227 34..247 214 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23569-PA 250 GD23569-PA 1..248 1..249 1027 84.5 Plus
Dsim\GD23570-PA 250 GD23570-PA 16..227 34..247 217 30.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18354-PA 262 GJ18354-PA 17..251 14..250 261 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24533-PA 270 GK24533-PA 15..257 15..255 373 36.6 Plus
Dwil\GK24532-PA 249 GK24532-PA 8..234 14..243 150 25.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18798-PA 258 GE18798-PA 1..255 1..255 797 71.4 Plus
Dyak\GE18799-PA 250 GE18799-PA 15..228 34..248 243 35 Plus

LP15408.hyp Sequence

Translation from 40 to 807

> LP15408.hyp
MNNRNRGWGRYGLRTGRPGGEPVPAEGPEVLVINERELRAFIFRVYLSSV
VLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPA
LTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYG
AKSPEVLLPNIICTCCIFLLLTVTMIVLLILFLIINDMRYLLALAIVFVI
LIAFMAPFQARFICGRLQQVPYGETADCANGIYLHFIFLLSCMLVFALYY
KLVNS*

LP15408.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32988-PA 255 CG32988-PA 1..255 1..255 1306 100 Plus
CG32983-PA 250 CG32983-PA 22..227 41..247 281 31.4 Plus
CG32987-PA 257 CG32987-PA 23..233 41..248 204 22.3 Plus