Clone LP15764 Report

Search the DGRC for LP15764

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:157
Well:64
Vector:pOT2
Associated Gene/TranscriptCG3348-RA
Protein status:LP15764.pep: gold
Sequenced Size:548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3348 2003-01-01 Sim4 clustering to Release 3
CG3348 2004-01-31 Blastp of sequenced clone
CG3348 2008-04-29 Release 5.5 accounting
CG3348 2008-08-15 Release 5.9 accounting
CG3348 2008-12-18 5.12 accounting

Clone Sequence Records

LP15764.complete Sequence

548 bp (548 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011537

> LP15764.complete
AATAACTCAGCAACAGCGAGCAACAGGCTGCTAGCCGTTAAAAATAACTA
ACGACCAAGAAATAGCACAAGAATTCCCCAAAAAACCGAACCCAATCACT
TGAACAAAATGCCTACCGCATCAGCACATCTGCCCATTCAGAAGCGCCGG
CCGCATGAGCACAATGGCGAGCCCAGCTGCCAGGGTCTAGATGAGGTGAA
CCGCATGTTCCGGAATTACTGGGATCCCACGGCCTACTGGGTGTGCGATA
AGCAGGGCACACGGGCTCGTCTCCAGCGCTGTCCGCAGTCGCAGCTCTAC
TCCGAGGAACTCGGCCGTTGCGTCCACTATGCCGATTGGGCCTGGACGGA
TCCCAAGGAGCCGGCTGGCCGAGCCAAGATCAGTCAATCGGTGTCCACAA
ATTAGTGATATCTTACGGCTAAACTTAATTTAATGCTAGTCTAAGACAAC
CAACCTCATTAGGCTTACGTCTATTTTTACAAAATACCTTTATTTTTAAT
GAAAATAAGAAAAAAAATCAGTACAAAATCAAAAAAAAAAAAAAAAAA

LP15764.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG3348-RA 942 CG3348-RA 409..942 1..534 2670 100 Plus
Hmu-RA 2406 Hmu-RA 2347..2406 534..475 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23114458..23114918 530..70 2215 98.7 Minus
chr3R 27901430 chr3R 23115049..23115119 71..1 355 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27291531..27291995 534..70 2325 100 Minus
3R 32079331 3R 27292126..27292196 71..1 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27032362..27032826 534..70 2325 100 Minus
3R 31820162 3R 27032957..27033027 71..1 355 100 Minus
Blast to na_te.dros performed 2019-03-15 22:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1111..1163 81..133 121 69.8 Plus

LP15764.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:35:56 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23114458..23114916 72..530 98 <- Minus
chr3R 23115049..23115119 1..71 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:57 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..297 109..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:21 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..297 109..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:06 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..297 109..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:34 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..297 109..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:29:06 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..297 109..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:49 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..523 8..530 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:21 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..523 8..530 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:06 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 14..543 1..530 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:35 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 1..523 8..530 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:29:06 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
CG3348-RA 14..543 1..530 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:56 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27291535..27291993 72..530 100 <- Minus
3R 27292126..27292196 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:56 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27291535..27291993 72..530 100 <- Minus
3R 27292126..27292196 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:35:56 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27291535..27291993 72..530 100 <- Minus
3R 27292126..27292196 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:06 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23117257..23117715 72..530 100 <- Minus
arm_3R 23117848..23117918 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:36 Download gff for LP15764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27032366..27032824 72..530 100 <- Minus
3R 27032957..27033027 1..71 100   Minus

LP15764.pep Sequence

Translation from 108 to 404

> LP15764.pep
MPTASAHLPIQKRRPHEHNGEPSCQGLDEVNRMFRNYWDPTAYWVCDKQG
TRARLQRCPQSQLYSEELGRCVHYADWAWTDPKEPAGRAKISQSVSTN*

LP15764.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18713-PA 99 GF18713-PA 1..97 1..96 450 86.6 Plus
Dana\GF16454-PA 79 GF16454-PA 5..78 17..90 201 45.9 Plus
Dana\GF16020-PA 95 GF16020-PA 8..93 5..89 133 32.6 Plus
Dana\GF18205-PA 97 GF18205-PA 21..95 16..89 130 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12118-PA 98 GG12118-PA 1..98 1..98 532 100 Plus
Dere\GG11500-PA 86 GG11500-PA 5..80 17..85 179 40.8 Plus
Dere\GG12307-PA 99 GG12307-PA 21..95 16..89 140 34.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23828-PA 88 GH23828-PA 2..88 4..90 392 79.3 Plus
Dgri\GH18866-PA 98 GH18866-PA 21..91 16..85 142 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3348-PB 98 CG3348-PB 1..98 1..98 555 100 Plus
CG3348-PA 98 CG3348-PA 1..98 1..98 555 100 Plus
CG14246-PC 93 CG14246-PC 5..87 17..85 190 38.6 Plus
CG14246-PB 93 CG14246-PB 5..87 17..85 190 38.6 Plus
CG14246-PA 93 CG14246-PA 5..87 17..85 190 38.6 Plus
CG14645-PA 97 CG14645-PA 21..95 16..89 143 33.3 Plus
Peritrophin-15a-PA 92 CG17814-PA 28..89 19..80 137 33.9 Plus
CG34282-PB 94 CG34282-PB 30..91 21..82 135 35.5 Plus
CG34282-PA 94 CG34282-PA 30..91 21..82 135 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24570-PA 89 GI24570-PA 2..86 4..88 393 81.2 Plus
Dmoj\GI24723-PA 97 GI24723-PA 21..95 16..89 145 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23592-PA 102 GL23592-PA 5..101 3..97 421 79.4 Plus
Dper\GL27220-PA 80 GL27220-PA 5..79 17..90 196 45.3 Plus
Dper\GL12319-PA 97 GL12319-PA 21..95 16..89 150 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17395-PA 102 GA17395-PA 5..101 3..97 421 79.4 Plus
Dpse\GA17212-PA 80 GA17212-PA 5..79 17..90 193 44 Plus
Dpse\GA13143-PA 97 GA13143-PA 21..95 16..89 150 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10110-PA 98 GM10110-PA 1..98 1..98 523 98 Plus
Dsec\GM10342-PA 89 GM10342-PA 5..83 17..85 174 39.2 Plus
Dsec\GM10746-PA 97 GM10746-PA 21..95 16..89 137 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18082-PA 98 GD18082-PA 1..98 1..98 525 99 Plus
Dsim\GD21302-PA 91 GD21302-PA 4..85 16..85 181 39 Plus
Dsim\GD19718-PA 97 GD19718-PA 21..95 16..89 140 34.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22636-PA 89 GJ22636-PA 2..88 4..90 409 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11341-PA 97 GK11341-PA 1..97 1..96 419 79.6 Plus
Dwil\GK18958-PA 84 GK18958-PA 9..78 17..85 204 50 Plus
Dwil\GK11657-PA 99 GK11657-PA 22..95 16..88 136 32.4 Plus
Dwil\GK13541-PA 106 GK13541-PA 30..97 19..85 129 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10567-PA 102 GE10567-PA 7..102 3..98 519 99 Plus
Dyak\GE23690-PA 89 GE23690-PA 5..88 17..90 176 35.7 Plus
Dyak\GE25408-PA 97 GE25408-PA 21..95 16..89 137 33.3 Plus

LP15764.hyp Sequence

Translation from 108 to 404

> LP15764.hyp
MPTASAHLPIQKRRPHEHNGEPSCQGLDEVNRMFRNYWDPTAYWVCDKQG
TRARLQRCPQSQLYSEELGRCVHYADWAWTDPKEPAGRAKISQSVSTN*

LP15764.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3348-PA 98 CG3348-PA 1..98 1..98 555 100 Plus
CG14246-PC 93 CG14246-PC 5..87 17..85 190 38.6 Plus
CG14246-PB 93 CG14246-PB 5..87 17..85 190 38.6 Plus
CG14246-PA 93 CG14246-PA 5..87 17..85 190 38.6 Plus
CG14645-PA 97 CG14645-PA 21..95 16..89 143 33.3 Plus