BDGP Sequence Production Resources |
Search the DGRC for LP16028
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 160 |
Well: | 28 |
Vector: | pOT2 |
Associated Gene/Transcript | Eig71Ef-RA |
Protein status: | LP16028.pep: gold |
Sequenced Size: | 428 |
Gene | Date | Evidence |
---|---|---|
CG7599 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7599 | 2003-03-31 | Blastp of sequenced clone |
Eig71Ef | 2008-04-29 | Release 5.5 accounting |
Eig71Ef | 2008-08-15 | Release 5.9 accounting |
Eig71Ef | 2008-12-18 | 5.12 accounting |
428 bp (428 high quality bases) assembled on 2003-03-31
GenBank Submission: BT011101
> LP16028.complete ATTTACTTGCACACAAGCTTAAAAATGCAATTGACAAGTATTATCTGCGT CATCTTGTTCCTTGGCTGTGTACTTATTAATGGACAAAGTCCCGACTGCC GAAAGTTAAGGGACACTTGCAATCCTTGCATCCGAAGACTCAATAATCCC ATCAATAATGTGGAGTTCATGAACGAGGGATGCCGTGAGAAAGTCCGTGG CAGATACATCTGGAAGAATCAGACTCGCTGCGATCTTCAAGTGATCGCTT GCAGTGCTCACAAGAGGAAACTGGATTGCTTGGTAATAGCCGAGCTTGCT GGGATGCCAAGGCGAACTTAGAAGAATGCCCACCAGCATTGTGATTACCA CAAGGGAGCGCAGCTAAAATATTAAAAGTGATTTTGTCCAAATAAATGCA TATGTGAAGAGAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ef-RA | 602 | Eig71Ef-RA | 86..497 | 1..412 | 2060 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord2 | 7650 | accord2 QBERT 7650bp | 5149..5235 | 215..126 | 127 | 64.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15646557..15646711 | 257..411 | 100 | <- | Minus |
chr3L | 15647028..15647283 | 1..256 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 1..297 | 25..321 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 1..297 | 25..321 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 1..297 | 25..321 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 1..297 | 25..321 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 1..297 | 25..321 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 21..431 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 21..431 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 21..431 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Eig71Ef-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15656655..15656809 | 257..411 | 100 | <- | Minus |
3L | 15657126..15657381 | 1..256 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15656655..15656809 | 257..411 | 100 | <- | Minus |
3L | 15657126..15657381 | 1..256 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15656655..15656809 | 257..411 | 100 | <- | Minus |
3L | 15657126..15657381 | 1..256 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15649755..15649909 | 257..411 | 100 | <- | Minus |
arm_3L | 15650226..15650481 | 1..256 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15650226..15650481 | 1..256 | 100 | Minus | |
3L | 15649755..15649909 | 257..411 | 100 | <- | Minus |
Translation from 0 to 320
> LP16028.hyp IYLHTSLKMQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNP INNVEFMNEGCREKVRGRYIWKNQTRCDLQVIACSAHKRKLDCLVIAELA GMPRRT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ef-PA | 98 | CG7599-PA | 1..98 | 9..106 | 532 | 100 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 1..96 | 9..106 | 318 | 54.1 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..96 | 9..104 | 272 | 47.9 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..97 | 9..104 | 182 | 37.1 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..98 | 9..105 | 170 | 33.7 | Plus |
Translation from 24 to 320
> LP16028.pep MQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNPINNVEFMN EGCREKVRGRYIWKNQTRCDLQVIACSAHKRKLDCLVIAELAGMPRRT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10381-PA | 99 | GF10381-PA | 1..98 | 1..98 | 374 | 69.4 | Plus |
Dana\GF10380-PA | 101 | GF10380-PA | 1..97 | 1..97 | 263 | 49.5 | Plus |
Dana\GF10385-PA | 102 | GF10385-PA | 1..101 | 1..97 | 139 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13527-PA | 98 | GG13527-PA | 1..98 | 1..98 | 466 | 90.8 | Plus |
Dere\GG13526-PA | 101 | GG13526-PA | 1..96 | 1..98 | 289 | 52 | Plus |
Dere\GG13530-PA | 100 | GG13530-PA | 1..98 | 1..97 | 148 | 30.6 | Plus |
Dere\GG15918-PA | 99 | GG15918-PA | 1..97 | 1..96 | 146 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Eig71Ef-PA | 98 | CG7599-PA | 1..98 | 1..98 | 532 | 100 | Plus |
Eig71Eh-PB | 101 | CG7594-PB | 1..96 | 1..98 | 318 | 54.1 | Plus |
Eig71Ej-PA | 98 | CG7588-PA | 1..96 | 1..96 | 272 | 47.9 | Plus |
Eig71Ed-PA | 99 | CG7350-PA | 1..97 | 1..96 | 182 | 37.1 | Plus |
Eig71Ea-PA | 100 | CG16931-PA | 1..98 | 1..97 | 170 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11686-PA | 94 | GI11686-PA | 1..92 | 1..97 | 146 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25491-PA | 98 | GL25491-PA | 1..98 | 1..98 | 372 | 70.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20470-PA | 98 | GA20470-PA | 1..98 | 1..98 | 364 | 69.4 | Plus |
Dpse\GA20285-PA | 100 | GA20285-PA | 1..97 | 1..96 | 178 | 39.2 | Plus |
Dpse\GA23630-PA | 214 | GA23630-PA | 119..211 | 1..96 | 138 | 31.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24471-PA | 98 | GM24471-PA | 1..98 | 1..98 | 451 | 88.8 | Plus |
Dsec\GM24470-PA | 98 | GM24470-PA | 1..96 | 1..96 | 259 | 47.9 | Plus |
Dsec\GM24474-PA | 100 | GM24474-PA | 1..98 | 1..97 | 164 | 34.7 | Plus |
Dsec\GM25550-PA | 99 | GM25550-PA | 20..97 | 20..96 | 145 | 41 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12545-PA | 98 | GD12545-PA | 1..98 | 1..98 | 491 | 95.9 | Plus |
Dsim\GD12544-PA | 101 | GD12544-PA | 1..96 | 1..98 | 279 | 52 | Plus |
Dsim\GD12543-PA | 98 | GD12543-PA | 1..96 | 1..96 | 259 | 47.9 | Plus |
Dsim\GD14563-PA | 99 | GD14563-PA | 20..97 | 20..96 | 140 | 39.7 | Plus |
Dsim\GD12548-PA | 100 | GD12548-PA | 1..79 | 1..78 | 139 | 34.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11358-PA | 96 | GJ11358-PA | 20..95 | 19..98 | 135 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20707-PA | 100 | GK20707-PA | 1..100 | 1..98 | 339 | 65 | Plus |
Dwil\GK20696-PA | 102 | GK20696-PA | 1..98 | 1..97 | 249 | 49 | Plus |
Dwil\GK15124-PA | 144 | GK15124-PA | 5..98 | 9..97 | 180 | 43.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19821-PA | 98 | GE19821-PA | 1..98 | 1..98 | 475 | 91.8 | Plus |
Dyak\GE22830-PA | 98 | GE22830-PA | 1..98 | 1..98 | 473 | 91.8 | Plus |
Dyak\GE19820-PA | 101 | GE19820-PA | 5..96 | 7..98 | 299 | 56.5 | Plus |
Dyak\GE22828-PA | 101 | GE22828-PA | 5..96 | 7..98 | 298 | 56.5 | Plus |
Dyak\GE22827-PA | 98 | GE22827-PA | 1..96 | 1..96 | 256 | 45.8 | Plus |