Clone LP16028 Report

Search the DGRC for LP16028

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:160
Well:28
Vector:pOT2
Associated Gene/TranscriptEig71Ef-RA
Protein status:LP16028.pep: gold
Sequenced Size:428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7599 2003-01-01 Sim4 clustering to Release 3
CG7599 2003-03-31 Blastp of sequenced clone
Eig71Ef 2008-04-29 Release 5.5 accounting
Eig71Ef 2008-08-15 Release 5.9 accounting
Eig71Ef 2008-12-18 5.12 accounting

Clone Sequence Records

LP16028.complete Sequence

428 bp (428 high quality bases) assembled on 2003-03-31

GenBank Submission: BT011101

> LP16028.complete
ATTTACTTGCACACAAGCTTAAAAATGCAATTGACAAGTATTATCTGCGT
CATCTTGTTCCTTGGCTGTGTACTTATTAATGGACAAAGTCCCGACTGCC
GAAAGTTAAGGGACACTTGCAATCCTTGCATCCGAAGACTCAATAATCCC
ATCAATAATGTGGAGTTCATGAACGAGGGATGCCGTGAGAAAGTCCGTGG
CAGATACATCTGGAAGAATCAGACTCGCTGCGATCTTCAAGTGATCGCTT
GCAGTGCTCACAAGAGGAAACTGGATTGCTTGGTAATAGCCGAGCTTGCT
GGGATGCCAAGGCGAACTTAGAAGAATGCCCACCAGCATTGTGATTACCA
CAAGGGAGCGCAGCTAAAATATTAAAAGTGATTTTGTCCAAATAAATGCA
TATGTGAAGAGAAAAAAAAAAAAAAAAA

LP16028.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ef-RA 602 Eig71Ef-RA 86..497 1..412 2060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15647028..15647283 256..1 1280 100 Minus
chr3L 24539361 chr3L 15646557..15646712 411..256 780 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15657126..15657381 256..1 1280 100 Minus
3L 28110227 3L 15656654..15656810 412..256 785 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15650226..15650481 256..1 1280 100 Minus
3L 28103327 3L 15649754..15649910 412..256 785 100 Minus
Blast to na_te.dros performed 2019-03-16 22:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 5149..5235 215..126 127 64.8 Minus

LP16028.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:15:52 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15646557..15646711 257..411 100 <- Minus
chr3L 15647028..15647283 1..256 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:42:59 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 1..297 25..321 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:44 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 1..297 25..321 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:17 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 1..297 25..321 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:10 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 1..297 25..321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:53 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 1..297 25..321 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:54 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 21..431 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:44 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 21..431 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:17 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:11 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 21..431 1..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:53 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ef-RA 10..420 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:52 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15656655..15656809 257..411 100 <- Minus
3L 15657126..15657381 1..256 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:52 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15656655..15656809 257..411 100 <- Minus
3L 15657126..15657381 1..256 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:52 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15656655..15656809 257..411 100 <- Minus
3L 15657126..15657381 1..256 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:17 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15649755..15649909 257..411 100 <- Minus
arm_3L 15650226..15650481 1..256 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:16 Download gff for LP16028.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15650226..15650481 1..256 100   Minus
3L 15649755..15649909 257..411 100 <- Minus

LP16028.hyp Sequence

Translation from 0 to 320

> LP16028.hyp
IYLHTSLKMQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNP
INNVEFMNEGCREKVRGRYIWKNQTRCDLQVIACSAHKRKLDCLVIAELA
GMPRRT*

LP16028.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ef-PA 98 CG7599-PA 1..98 9..106 532 100 Plus
Eig71Eh-PB 101 CG7594-PB 1..96 9..106 318 54.1 Plus
Eig71Ej-PA 98 CG7588-PA 1..96 9..104 272 47.9 Plus
Eig71Ed-PA 99 CG7350-PA 1..97 9..104 182 37.1 Plus
Eig71Ea-PA 100 CG16931-PA 1..98 9..105 170 33.7 Plus

LP16028.pep Sequence

Translation from 24 to 320

> LP16028.pep
MQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNPINNVEFMN
EGCREKVRGRYIWKNQTRCDLQVIACSAHKRKLDCLVIAELAGMPRRT*

LP16028.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10381-PA 99 GF10381-PA 1..98 1..98 374 69.4 Plus
Dana\GF10380-PA 101 GF10380-PA 1..97 1..97 263 49.5 Plus
Dana\GF10385-PA 102 GF10385-PA 1..101 1..97 139 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13527-PA 98 GG13527-PA 1..98 1..98 466 90.8 Plus
Dere\GG13526-PA 101 GG13526-PA 1..96 1..98 289 52 Plus
Dere\GG13530-PA 100 GG13530-PA 1..98 1..97 148 30.6 Plus
Dere\GG15918-PA 99 GG15918-PA 1..97 1..96 146 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ef-PA 98 CG7599-PA 1..98 1..98 532 100 Plus
Eig71Eh-PB 101 CG7594-PB 1..96 1..98 318 54.1 Plus
Eig71Ej-PA 98 CG7588-PA 1..96 1..96 272 47.9 Plus
Eig71Ed-PA 99 CG7350-PA 1..97 1..96 182 37.1 Plus
Eig71Ea-PA 100 CG16931-PA 1..98 1..97 170 33.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11686-PA 94 GI11686-PA 1..92 1..97 146 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25491-PA 98 GL25491-PA 1..98 1..98 372 70.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20470-PA 98 GA20470-PA 1..98 1..98 364 69.4 Plus
Dpse\GA20285-PA 100 GA20285-PA 1..97 1..96 178 39.2 Plus
Dpse\GA23630-PA 214 GA23630-PA 119..211 1..96 138 31.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24471-PA 98 GM24471-PA 1..98 1..98 451 88.8 Plus
Dsec\GM24470-PA 98 GM24470-PA 1..96 1..96 259 47.9 Plus
Dsec\GM24474-PA 100 GM24474-PA 1..98 1..97 164 34.7 Plus
Dsec\GM25550-PA 99 GM25550-PA 20..97 20..96 145 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12545-PA 98 GD12545-PA 1..98 1..98 491 95.9 Plus
Dsim\GD12544-PA 101 GD12544-PA 1..96 1..98 279 52 Plus
Dsim\GD12543-PA 98 GD12543-PA 1..96 1..96 259 47.9 Plus
Dsim\GD14563-PA 99 GD14563-PA 20..97 20..96 140 39.7 Plus
Dsim\GD12548-PA 100 GD12548-PA 1..79 1..78 139 34.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11358-PA 96 GJ11358-PA 20..95 19..98 135 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20707-PA 100 GK20707-PA 1..100 1..98 339 65 Plus
Dwil\GK20696-PA 102 GK20696-PA 1..98 1..97 249 49 Plus
Dwil\GK15124-PA 144 GK15124-PA 5..98 9..97 180 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19821-PA 98 GE19821-PA 1..98 1..98 475 91.8 Plus
Dyak\GE22830-PA 98 GE22830-PA 1..98 1..98 473 91.8 Plus
Dyak\GE19820-PA 101 GE19820-PA 5..96 7..98 299 56.5 Plus
Dyak\GE22828-PA 101 GE22828-PA 5..96 7..98 298 56.5 Plus
Dyak\GE22827-PA 98 GE22827-PA 1..96 1..96 256 45.8 Plus