Clone LP16467 Report

Search the DGRC for LP16467

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:164
Well:67
Vector:pOT2
Associated Gene/TranscriptCG2113-RA
Protein status:LP16467.pep: gold
Sequenced Size:899

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2113 2009-06-05 Manual selection by Joe Carlson

Clone Sequence Records

LP16467.complete Sequence

899 bp assembled on 2009-08-10

GenBank Submission: BT099524.1

> LP16467.complete
CGGTTCGATACTGACAAACATTTTCGGCAAACATCCGTTCAAATTTCCAG
CATAATTATAAAATGGCTGAAAGTCAGGAATCCCCGCAGGATTCGTCGGT
CTCGTCACGCATCACGCTCTTCAACCAACAAGCTGAGCAGCATAAAAACT
GGATGATGATAAACCCCTTTGCCCATTACAACGTCAACGAGATGCCCAAG
AGGACCTTTCCAGAGGAGGAATACGGCAGAGCTCCGACGGGCAGTCTTTC
CGAGCAGAGATCCTTGCAGGCCAATGTACGTGCTCTGGAGGAGATTCTCC
AACTGTGCGATTTGATACAGAAATCCGGTCGTGATGATCCCATTGATGGC
CGAAAGGTACTAGCTTTCGGGCAACTATTTGAAACTTACAACAATATCTC
CGACAAGTTGCTTGCCACTCTGTTGGGTGCCCGAAAGTATGGGTTCGTAG
ACTTTAGCGGAGAAACCCTTTTTCAAGGTCGTGATGATACAGAACCCGTC
CGCCTGCTTCGCCCCTTCGAGGAGCTCCAAGCCGAAATCATTTCCAAGGT
CGCCGATCTGCGCTGCGATTTCACTGAAAAACCGGAGGAACCGACTCTGC
TTCGCGAGGATTAGGTGATGTTTTCTGCTTAAAAGTGGGCCAGAAACTGT
CATCTACCTTTGACCCGTTTCAAAACCACGCGCACGTGTTCACCTCTGAG
CCCTTTTGCTAATTGAATTAAAGTCTGGGTTCCCGGCCAAAAGGCTTTTA
ACCAACAGCGAAAACCCGCCAATCCCATCACGTATACGACAAGAGGGCCC
TCTCGCAAACACCTGTCGCTATGGTTTTTTAATAACACACCGCAGGGGTT
TTACCTCCAGGAAATAAACAAATTATAGCCGAAAAAAAAAAAAAAAAAA

LP16467.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2113-RA 1046 CG2113-RA 46..927 1..882 4410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2994710..2995515 76..881 3970 99.5 Plus
chr3L 24539361 chr3L 2994577..2994654 1..78 390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2995321..2996127 76..882 4035 100 Plus
3L 28110227 3L 2995188..2995265 1..78 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2995321..2996127 76..882 4035 100 Plus
3L 28103327 3L 2995188..2995265 1..78 390 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:49:23 has no hits.

LP16467.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:50:29 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2994577..2994653 1..77 100 -> Plus
chr3L 2994712..2995515 78..881 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:22 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 1..552 63..614 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:18 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 1..552 63..614 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:39 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 1..552 63..614 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:30 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 1..552 63..614 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 14:34:29 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 9..889 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:18 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 9..889 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:39 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 17..897 1..881 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:30 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
CG2113-RA 17..897 1..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:29 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2995188..2995264 1..77 100 -> Plus
3L 2995323..2996126 78..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:29 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2995188..2995264 1..77 100 -> Plus
3L 2995323..2996126 78..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:29 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2995188..2995264 1..77 100 -> Plus
3L 2995323..2996126 78..881 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:39 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2995188..2995264 1..77 100 -> Plus
arm_3L 2995323..2996126 78..881 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:52 Download gff for LP16467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2995323..2996126 78..881 100   Plus
3L 2995188..2995264 1..77 100 -> Plus

LP16467.pep Sequence

Translation from 62 to 613

> LP16467.pep
MAESQESPQDSSVSSRITLFNQQAEQHKNWMMINPFAHYNVNEMPKRTFP
EEEYGRAPTGSLSEQRSLQANVRALEEILQLCDLIQKSGRDDPIDGRKVL
AFGQLFETYNNISDKLLATLLGARKYGFVDFSGETLFQGRDDTEPVRLLR
PFEELQAEIISKVADLRCDFTEKPEEPTLLRED*

LP16467.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24258-PA 187 GF24258-PA 1..187 1..183 696 71.1 Plus
Dana\GF21072-PA 397 GF21072-PA 16..190 10..183 381 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14895-PA 183 GG14895-PA 1..183 1..183 895 91.3 Plus
Dere\GG12911-PA 431 GG12911-PA 70..244 10..183 377 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16995-PA 190 GH16995-PA 1..177 1..175 540 57.6 Plus
Dgri\GH24296-PA 430 GH24296-PA 16..187 10..180 381 41.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2113-PA 183 CG2113-PA 1..183 1..183 943 100 Plus
CG2113-PB 179 CG2113-PB 1..179 1..183 907 97.8 Plus
CG3630-PD 371 CG3630-PD 16..190 10..183 367 41.2 Plus
CG3630-PC 371 CG3630-PC 16..190 10..183 367 41.2 Plus
CG3630-PA 371 CG3630-PA 16..190 10..183 367 41.2 Plus
CG3630-PB 347 CG3630-PB 1..166 19..183 344 41.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11408-PA 218 GI11408-PA 26..196 9..177 523 58.5 Plus
Dmoj\GI16419-PA 407 GI16419-PA 16..187 10..180 376 41.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20214-PA 370 GL20214-PA 16..185 10..178 371 40.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17571-PA 370 GA17571-PA 16..185 10..178 371 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14520-PA 176 GM14520-PA 2..176 9..183 918 97.7 Plus
Dsec\GM19201-PA 355 GM19201-PA 16..190 10..183 378 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13717-PA 176 GD13717-PA 2..176 9..183 918 97.7 Plus
Dsim\GD16590-PA 353 GD16590-PA 1..166 19..183 354 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13604-PA 187 GJ13604-PA 3..183 4..182 538 58 Plus
Dvir\GJ17040-PA 391 GJ17040-PA 16..187 10..180 368 40.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16575-PA 187 GK16575-PA 17..182 16..181 547 62.7 Plus
Dwil\GK25143-PA 382 GK25143-PA 16..185 10..178 371 41.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20348-PA 179 GE20348-PA 1..179 1..183 884 91.3 Plus
Dyak\GE16240-PA 380 GE16240-PA 16..190 10..183 376 41.2 Plus

LP16467.hyp Sequence

Translation from 62 to 613

> LP16467.hyp
MAESQESPQDSSVSSRITLFNQQAEQHKNWMMINPFAHYNVNEMPKRTFP
EEEYGRAPTGSLSEQRSLQANVRALEEILQLCDLIQKSGRDDPIDGRKVL
AFGQLFETYNNISDKLLATLLGARKYGFVDFSGETLFQGRDDTEPVRLLR
PFEELQAEIISKVADLRCDFTEKPEEPTLLRED*

LP16467.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2113-PA 183 CG2113-PA 1..183 1..183 943 100 Plus
CG2113-PB 179 CG2113-PB 1..179 1..183 907 97.8 Plus
CG3630-PD 371 CG3630-PD 16..190 10..183 367 41.2 Plus
CG3630-PC 371 CG3630-PC 16..190 10..183 367 41.2 Plus
CG3630-PA 371 CG3630-PA 16..190 10..183 367 41.2 Plus